KEGG   Treponema primitia: TREPR_1368Help
Entry
TREPR_1368        CDS       T01507                                 

Gene name
rluD_2
Definition
ribosomal large subunit pseudouridine synthase D
Orthology
K06180  
23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
tpi  Treponema primitia
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2932156..2932869)
Genome map
AA seq 237 aa AA seqDB search
MKPAYPRTLAQGLVLIYEDRDILVADKPPGLLSIATGSEREKTAYWILSEYLRKKGEKRR
AAVVHRLDRDTSGVMLFAKSEAVKRKLMEHWDETVEERRYLALAEGEFAEAQGIIDAPLG
EDSRGRVVVVRGGQQNGAASKTWRAITHWKLLKAGNGFSLLSLELETGRRNQIRAHLAHL
GHPVAGDPKYGAKTNPLKRLCLHAEVLVFHHPHDGKLMEFEVKVPGGFFQVLGPRSR
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctgcctatccccgcactctggcccagggcctggttctcatctacgaggatcgg
gatatcctggtggcagataagcccccgggactgctctccattgccacaggatcggaacgg
gaaaaaaccgcctactggatactctcggaatacctccgcaaaaagggggaaaagcgcagg
gctgcggtggttcaccggctggaccgggatacttcgggggtcatgctttttgccaagtcc
gaagcggtcaagcggaaacttatggaacactgggatgagacggtagaggaacggcgctac
cttgccctggctgagggtgagtttgccgaagcccaggggatcatcgacgcgcccttgggt
gaggatagccggggtcgggttgtggtggtccggggtgggcagcaaaacggagctgcatcg
aaaacatggcgggccattacccattggaagctcctgaaggcgggcaacggtttttccctc
ctgtccctggaactggaaaccggccgccgcaaccagatccgcgcccacctggcccatctg
ggtcatcctgtggcgggggaccctaaatacggggcaaagacaaatcccctgaaacggctt
tgcctccacgcggaagtgctggtatttcaccacccccatgacgggaagctcatggaattt
gaggtgaaggtgccggggggattttttcaggttttagggccccgcagccggtga

DBGET integrated database retrieval system