KEGG   Treponema primitia: TREPR_1800Help
Entry
TREPR_1800        CDS       T01507                                 

Definition
acyl-coenzyme A synthetase ACSM3 (EC:6.2.1.2)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tpi  Treponema primitia
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:tpi01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tpi00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:tpi00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:tpi00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:tpi00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2453645..2455387)
Genome map
AA seq 580 aa AA seqDB search
MLEKYLSRDTFDSYEDYYNNYSVNIPENFNFAWDVMDTIAAERGNDRALVWRDEKGAEAE
FTYGDIKRLSDKAAQVFLDAGIGKGDPVMIILKRRHEYWPTLLALHKIGAIAIPATHLLT
VKDIVYRVEAADIAGIVCVDDEQVMNRVDEALAKMHSNTARKVSLRYKAFVRSVHSPKEA
QPGKAAKSPWADFNFLVEKAPDNFTRPPKVNTNNDTMLLYFTSGTTGMPKMVQHDFAYPL
GHIATAKYWHQVVPGGLHLTVSDTGWAKAAWGKIYGQWLCGTAIFVYDYDRFDPPAMLEI
ISKNRLTTFCAPPTVYRFFIKEDLKKYDFSSLKHCTVAGEPLNPEIFEQFLAGTGLKLHE
CYGQTELTVTMVTLQWMEPKPGSMGRPSPGYDVDLLREDGSSCDMGEEGQLVVRTDRRRP
IGMFHGYYRDEALTKSVWHDDVYHTGDVAWRDEDGYYWFVGRSDDVIKSSGYRIGPFEVE
SALMEHPAVLECAITGVPDADRGTVVKATVILAKGWSASEELKLELQNHVKKTTAPYKYP
RIIEFVSELPKTISGKIRRVQIRAEDTGSADTGGPGLSPD
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgctggagaaatatttatcccgggatacctttgattcctatgaggattattacaacaat
tattctgtgaacataccggaaaattttaactttgcctgggatgtgatggataccattgct
gctgagcgaggaaatgatcgggctctggtatggcgtgacgaaaaaggcgccgaagcggaa
tttacctacggcgatataaaacggctctcggataaggcggcccaggtgttcctggatgcg
ggcataggcaagggagacccggtgatgattatcctcaagcgccgccatgaatactggccc
acgctcctggccctccacaaaatcggcgccattgccattcctgcgacccatctcctgacc
gtcaaggatattgtttacagggttgaggctgcggacatagccgggattgtctgcgtggac
gatgaacaggtgatgaatcgtgttgatgaggctctggcaaaaatgcatagtaatactgcg
agaaaagtatccctgcgctacaaggcctttgtgcgatccgtccattcccctaaagaggca
cagcccggaaaagcagccaagtcgccatgggctgattttaattttcttgtggaaaaagct
ccggataattttacccgccctccaaaggtgaacaccaataatgacaccatgctcctctac
tttacctcgggcaccacggggatgcccaagatggtgcagcatgactttgcctatcccctg
gggcacattgccaccgcaaaatactggcaccaggtggtccccgggggactccaccttacc
gtttcagacaccggctgggccaaggccgcctggggcaaaatttacgggcagtggctctgc
gggaccgcaatatttgtgtacgattacgatcgctttgatcccccggcgatgctggaaatt
atttccaaaaaccggcttaccaccttttgcgccccccctacggtgtatcgcttctttatc
aaggaagatctgaaaaaatacgatttttcttccctgaaacactgtaccgttgcgggggaa
cccctgaacccggagatattcgagcagtttctcgcgggtacggggctcaagctccacgaa
tgttacggccagaccgaactcacggttacaatggttaccttacaatggatggaacctaag
cccggctccatgggtaggccctccccgggctatgacgtggacctcctccgggaagatggc
agctcctgcgatatgggggaagaaggccagctggtggtccgcacagaccggcgtaggccc
ataggaatgtttcacggctattaccgggatgaagcgctcactaaaagtgtgtggcacgat
gatgtctaccataccggtgatgttgcctggcgggatgaagacggttactactggtttgtg
ggccgttccgacgatgtgatcaaaagctcaggctaccgcattggcccttttgaagtggaa
agcgccctcatggaacatccagcagtcctggaatgcgccatcaccggtgtccccgatgca
gaccggggcacagtggtcaaagccacagtaatcctcgccaagggctggtccgcttcggag
gaactgaagctggagctccagaaccatgtgaagaagactaccgcaccctataagtacccc
cggataatagagtttgtaagcgaacttcccaagaccatcagcggtaaaattcgccgggta
cagatccgggcggaagatacgggaagcgcggataccggcgggccagggctttccccggat
taa

DBGET integrated database retrieval system