KEGG   Treponema primitia: TREPR_1800Help
Entry
TREPR_1800        CDS       T01507                                 

Definition
acyl-coenzyme A synthetase ACSM3 (EC:6.2.1.2)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tpi  Treponema primitia
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tpi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TREPR_1800
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TREPR_1800
   00620 Pyruvate metabolism
    TREPR_1800
   00640 Propanoate metabolism
    TREPR_1800
  Energy metabolism
   00680 Methane metabolism
    TREPR_1800
Enzymes [BR:tpi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     TREPR_1800
Lipid biosynthesis proteins [BR:tpi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TREPR_1800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2453645..2455387)
Genome map
AA seq 580 aa AA seqDB search
MLEKYLSRDTFDSYEDYYNNYSVNIPENFNFAWDVMDTIAAERGNDRALVWRDEKGAEAE
FTYGDIKRLSDKAAQVFLDAGIGKGDPVMIILKRRHEYWPTLLALHKIGAIAIPATHLLT
VKDIVYRVEAADIAGIVCVDDEQVMNRVDEALAKMHSNTARKVSLRYKAFVRSVHSPKEA
QPGKAAKSPWADFNFLVEKAPDNFTRPPKVNTNNDTMLLYFTSGTTGMPKMVQHDFAYPL
GHIATAKYWHQVVPGGLHLTVSDTGWAKAAWGKIYGQWLCGTAIFVYDYDRFDPPAMLEI
ISKNRLTTFCAPPTVYRFFIKEDLKKYDFSSLKHCTVAGEPLNPEIFEQFLAGTGLKLHE
CYGQTELTVTMVTLQWMEPKPGSMGRPSPGYDVDLLREDGSSCDMGEEGQLVVRTDRRRP
IGMFHGYYRDEALTKSVWHDDVYHTGDVAWRDEDGYYWFVGRSDDVIKSSGYRIGPFEVE
SALMEHPAVLECAITGVPDADRGTVVKATVILAKGWSASEELKLELQNHVKKTTAPYKYP
RIIEFVSELPKTISGKIRRVQIRAEDTGSADTGGPGLSPD
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgctggagaaatatttatcccgggatacctttgattcctatgaggattattacaacaat
tattctgtgaacataccggaaaattttaactttgcctgggatgtgatggataccattgct
gctgagcgaggaaatgatcgggctctggtatggcgtgacgaaaaaggcgccgaagcggaa
tttacctacggcgatataaaacggctctcggataaggcggcccaggtgttcctggatgcg
ggcataggcaagggagacccggtgatgattatcctcaagcgccgccatgaatactggccc
acgctcctggccctccacaaaatcggcgccattgccattcctgcgacccatctcctgacc
gtcaaggatattgtttacagggttgaggctgcggacatagccgggattgtctgcgtggac
gatgaacaggtgatgaatcgtgttgatgaggctctggcaaaaatgcatagtaatactgcg
agaaaagtatccctgcgctacaaggcctttgtgcgatccgtccattcccctaaagaggca
cagcccggaaaagcagccaagtcgccatgggctgattttaattttcttgtggaaaaagct
ccggataattttacccgccctccaaaggtgaacaccaataatgacaccatgctcctctac
tttacctcgggcaccacggggatgcccaagatggtgcagcatgactttgcctatcccctg
gggcacattgccaccgcaaaatactggcaccaggtggtccccgggggactccaccttacc
gtttcagacaccggctgggccaaggccgcctggggcaaaatttacgggcagtggctctgc
gggaccgcaatatttgtgtacgattacgatcgctttgatcccccggcgatgctggaaatt
atttccaaaaaccggcttaccaccttttgcgccccccctacggtgtatcgcttctttatc
aaggaagatctgaaaaaatacgatttttcttccctgaaacactgtaccgttgcgggggaa
cccctgaacccggagatattcgagcagtttctcgcgggtacggggctcaagctccacgaa
tgttacggccagaccgaactcacggttacaatggttaccttacaatggatggaacctaag
cccggctccatgggtaggccctccccgggctatgacgtggacctcctccgggaagatggc
agctcctgcgatatgggggaagaaggccagctggtggtccgcacagaccggcgtaggccc
ataggaatgtttcacggctattaccgggatgaagcgctcactaaaagtgtgtggcacgat
gatgtctaccataccggtgatgttgcctggcgggatgaagacggttactactggtttgtg
ggccgttccgacgatgtgatcaaaagctcaggctaccgcattggcccttttgaagtggaa
agcgccctcatggaacatccagcagtcctggaatgcgccatcaccggtgtccccgatgca
gaccggggcacagtggtcaaagccacagtaatcctcgccaagggctggtccgcttcggag
gaactgaagctggagctccagaaccatgtgaagaagactaccgcaccctataagtacccc
cggataatagagtttgtaagcgaacttcccaagaccatcagcggtaaaattcgccgggta
cagatccgggcggaagatacgggaagcgcggataccggcgggccagggctttccccggat
taa

DBGET integrated database retrieval system