KEGG   Treponema primitia: TREPR_1803Help
Entry
TREPR_1803        CDS       T01507                                 

Definition
putative sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
tpi  Treponema primitia
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:tpi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TREPR_1803
Enzymes [BR:tpi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     TREPR_1803
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2449080..2450915)
Genome map
AA seq 611 aa AA seqDB search
MGDNEKSEALQNLLVFIYGDKPGRETHAKLLSILEGVEHGPGLQGFTHRDAFLISYGDML
APAGGDRGSAAEDPSGEAVAELPGSALADTFPAETGLSWLGNFLERRNEGAFTYLHLLPF
HPYSSDDGFSVVDYREVDPRFGTWEDIAALGKGFKLAFDFVVNHGSVKSPWFQGFLAGDK
RYEGWYTTRPKDYDYSAVTRPRTHPLLTPFTRKDGSEVYVWTTFSADQVDYDFSNPEVLL
EFIRIFLEFAKRGARIIRLDAIGYLWKEDGHPCIHHAKTHAVVKLFRAIAETLGLDLLLL
TETNVPHLQNVAYFGTGDEAHMVYNFALPPLVLHSLLSADSGPLRSWAKTLPPYSEKGWL
FLNYLASHDGVGLGPAKGLVDDAAFALSIEEAQRRGALVSYKATPEGPIPYELNCSYVSL
AAPPSLGSAEIRARAFLASQGVLLSLAGLPAVYFHSWIGSEAWTEGPELLGYNRAINRER
PPIDRVDRELDDPHSLRSLIYRGIKGFLQFRKAEEAFSPEIPQRILDADGAVFAVLRGPV
GGFPAKAKAGSAGISSRYVLCAQNLGAKPATLRLRENGIPLEGIAGEELALAPWETRWIA
YGGGEKRELST
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgggggataacgaaaagagcgaagctctgcaaaacttgcttgtctttatttatggcgat
aagccgggccgggagacccatgcaaaactgctttcgatactggaaggagtcgaacatggc
ccgggcctgcagggatttacccaccgggatgcctttctgatcagctacggggatatgctg
gcccctgcaggtggggaccggggaagtgcggcggaagatccaagcggggaagctgtggct
gaactcccggggtcggctttagccgacacgttccctgcggaaaccggcctgtcctggctg
ggaaacttcctggaacgccgcaacgaaggtgctttcacctacctccacctgctccccttt
cacccctatagttccgatgacggcttttccgtggtggattaccgggaggtggacccccgt
tttggaacctgggaggacatcgccgccctgggcaagggctttaagctggcctttgatttt
gtggtgaaccacggcagcgtaaaaagcccctggtttcagggcttcctggccggggacaaa
cgctatgagggctggtacaccacccggcctaaggactatgactattccgccgtgacccgt
ccccggacccaccccttgctgaccccctttacacgtaaggatggttcagaagtatacgta
tggaccactttcagcgccgatcaagttgattatgacttcagcaacccggaagtgcttctg
gaatttatcaggatctttctggaatttgccaaaaggggcgcacggataattcgccttgac
gccatcggctacctttggaaggaggatggccacccctgcatccaccatgccaagacccat
gctgtggtaaaactcttccgggccatcgccgaaaccctgggcctggacctgcttttactc
acggaaaccaacgtgccccacctccagaatgtggcctactttggtactggggacgaggcc
cacatggtgtacaactttgccctgccgcccctggtcctccacagcctgctttccgctgac
agcggccccctgcgcagctgggccaaaaccctgcccccctattcggaaaaaggctggctt
ttcctcaactacctggcaagccacgatggtgtaggcttgggccccgccaagggcctggtg
gatgatgctgcctttgccctttccatagaagaagcccagcgacgcggcgccctggtcagc
tacaaggctactcccgagggccccatcccctacgaactgaactgttcctatgtaagcctg
gccgcccccccgtccttgggctcagcggaaatccgcgcccgggcctttctggcctcccag
ggtgtgctcctctccctggcagggctcccggcggtgtacttccacagctggataggctcc
gaagcctggacagaagggccggaacttctgggctataaccgggctataaaccgggaacgc
cccccaatagatcgggttgatcgtgaactggatgatccccactccctgcgctccctgata
taccgggggatcaagggcttcctccaatttagaaaggccgaggaagccttttccccggag
attccccagcgcatacttgacgcagatggggcggttttcgccgtgctgcggggtcccgtg
gggggatttcccgctaaagccaaggccggcagcgccgggatctcaagccgttatgtactc
tgcgcccagaacctgggggctaagcctgcgacactgcggctccgagagaatggcattccc
cttgaaggtattgcgggggaagaactggccctggcgccctgggaaacccggtggatcgcc
tacgggggtggagaaaagcgggaattatcgacatga

DBGET integrated database retrieval system