KEGG   Treponema primitia: TREPR_1966Help
Entry
TREPR_1966        CDS       T01507                                 

Definition
alpha galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
tpi  Treponema primitia
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:tpi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    TREPR_1966
  Lipid metabolism
   00561 Glycerolipid metabolism
    TREPR_1966
   00600 Sphingolipid metabolism
    TREPR_1966
Enzymes [BR:tpi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     TREPR_1966
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2295496..2297352
Genome map
AA seq 618 aa AA seqDB search
MELIQTKGPLPTGLAGTLLRYTAGAAGQIARERGGAFEIALWPFEELMNFAGLEGADQEA
FGDPTQLTVQCGGWQSWSAGWELAAGETLPNRVLIIPELLKLTNRPGDTETLADRSGKDW
LIGHFIMYIRAGDRYLCIAALDEGPPVTYRINMKRGLVSAEIYCPGKTWAEGEAAATLAV
FSVQGFFSLKDALRKLYGQEESFKTTAFLGKIPGGYESWYNHYTNINEKLILGDLENLGK
TENIIKLHYLDSKKPVVFQIDDGWEKAVGEWEINYKRFPQGLAPVASQIEQAGYIPGLWF
APFLVIKKARIFREKPEWVLREKPGGKPVVAGFNHLWDKQYYCLDISREDVLDYLGGLIN
RAVDEWGFRYLKLDFLYTGLFNGAFANPGSPHEHYRRACAVLTGRSATRTGLPVAYLGCG
LPLGPSYRRFPLSRIGADTKAEWDWKLVKCLGHTGRPSAYINLMDTIGRSFMNGSVYIND
PDVIFLRSQNCRLTANEKELIALVNFLLAGQIMFSDNPLQLSPDDLALSGHIAELYRSLE
GDEYGVRRLDRDLFRLESRSRKTTGIINLSEKPWQVSGDETEGGFYAILKEGEYIIDHRI
GGTMNFAPHTITILRIKK
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atggaacttatacaaacaaagggcccattgccaaccgggttagccgggacattgctgcgc
tatactgccggagctgcggggcaaattgcaagggaaaggggcggggcttttgaaatcgcc
ctctggccctttgaggaattaatgaattttgccggcctggaaggggcggaccaggaggct
ttcggagatcctacgcaactgacggtccaatgcgggggctggcaatcctggtctgcgggc
tgggaactggctgcgggggaaaccttgccgaatcgggtcctgattatcccggagttgtta
aagcttaccaaccgtccaggggacaccgagacactggctgaccggagcggcaaagactgg
cttattggacacttcatcatgtatatcagagcaggagaccgctacctctgtatagctgct
ctggatgaggggcctccggtaacgtaccggatcaatatgaagcggggattggtcagcgcg
gagatctactgcccggggaaaacctgggcggagggggaagcggcggcaacgctggcggtt
ttttccgttcagggattcttttccctgaaggatgcactgagaaaactctacgggcaggaa
gagagcttcaaaaccactgccttcctgggtaagatccccgggggatacgaatcctggtac
aaccactacacgaatatcaatgaaaaactcatcctgggagatctggaaaatctgggaaaa
accgaaaacatcatcaagctccattacctggattcaaaaaagcccgtggtattccagata
gacgacggttgggaaaaggctgtgggggaatgggaaatcaattacaagcgcttccctcag
ggactcgccccggtggcttcacaaatcgaacaggccgggtacatacccggcctctggttc
gcgccttttctggtgataaaaaaagcccgcatattcagggaaaaacccgaatgggtcctg
agggaaaagccgggtggtaagcccgtggtggcagggttcaaccacctctgggacaaacag
tattactgtctggacatatcccgggaggatgtactggattaccttggggggcttataaac
cgagcggtcgatgaatggggcttccgctatctcaaactggacttcctctacacaggcctc
tttaacggggcctttgccaatcccggcagccctcacgaacactaccgccgggcctgcgct
gtcctaaccggccgtagcgctaccaggaccgggcttccggtggcctacctgggctgcggc
ctccccctggggccttcctaccgccgcttccccctctcccgtatcggggcggacacaaag
gccgagtgggactggaaactggtaaaatgcctgggccacacaggccggccctcggcctat
ataaatctcatggacaccataggccgttcctttatgaacggctcggtgtacatcaacgat
ccggatgtgatcttcctcagaagccaaaactgccggctcacggccaatgaaaaggaactt
atcgccctggtcaatttcctcctggcaggacaaatcatgttttccgacaatccccttcag
ctaagccctgatgacctggccctgtccgggcatattgcggaactgtaccgcagcctggag
ggggatgagtatggggtaaggcggctggaccgggatctgttccgcctggaaagccggtcc
aggaaaaccacgggcatcatcaacctttccgaaaagccctggcaggtctccggggatgag
acagaaggcggtttttatgctatactaaaggaaggagagtatattattgatcaccgtatc
ggagggaccatgaattttgcaccccatacaattacgatcctacggataaagaaataa

DBGET integrated database retrieval system