KEGG   Treponema primitia: TREPR_2426Help
Entry
TREPR_2426        CDS       T01507                                 

Definition
(GenBank) endoglucanase M (EGM) (Endo-1,4-beta-glucanase)(Cellulase M)
Organism
tpi  Treponema primitia
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1790293..1791318
Genome map
AA seq 341 aa AA seqDB search
MSIIALLRELCTLDGVSGMEAEVRDYIIKKAKPHAEELQVDPLGNVLVLRKGKKRPEKRV
MLCAHMDEVGFIIKDISPEGLLKFSALGGIDRRVILGKRLKVGPKKLPGVLSIKAYHLVD
KEEEKVSPKIDDLFIDIGAQSREEAEKLVSIGDICSFDSDFVEFGNGFVKAKAIDDRIGC
AVMLRLIEEEPAVDTWFAFVTQEELGLRGSPGAAFAIHPEIALILESTTAADLPSVEGHR
KSCSPGKGAVLPFMDNSAIYDHAMFDDLRRIAIEKGILWQYKTIVAGGTDAGSIQRSHEG
VQVAVIAAAVRCIHSPICIAYAPDFEEILKLARAYLEYLGE
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgagtataattgcgttgttacgggaactgtgcaccctggatggcgtttcggggatggaa
gctgaagttcgggattatatcattaaaaaggccaaaccccatgcagaggaactgcaggtt
gaccccctggggaatgtgctggtgctgcgcaagggaaaaaagcggcctgagaagcgggtg
atgctctgcgcccacatggacgaggtgggcttcattatcaaggatattagccccgaaggg
ctgcttaaattcagcgccctgggcgggatagaccgccgggttattttgggcaagcgcctc
aaggtgggccccaaaaaactccccggggttctttcgataaaggcctatcacctggttgat
aaagaagaagaaaaagtaagcccaaaaatcgacgaccttttcattgatatcggcgcccaa
agccgggaggaagctgaaaagcttgtatccatcggggatatttgtagctttgacagtgat
tttgttgaatttggcaatggctttgtaaaggccaaggccatagatgaccgcataggctgt
gccgtaatgctgcgcctcattgaagaggagccggcggtggacacctggtttgcctttgtg
acccaggaagagctgggccttaggggcagccctggggcggcctttgccattcatcctgaa
attgcccttatcctggagagcaccaccgccgctgacctgcccagtgtcgaaggccaccgc
aaatcctgttcccctggcaagggggcggtactgcccttcatggataattccgccatttac
gaccatgcaatgtttgatgatctgcgccgtattgccatcgaaaagggcatactatggcaa
tacaaaaccattgtcgccgggggcaccgacgcagggagcatacagcgtagccatgagggg
gtacaggttgccgtgatagccgcggcagttcgttgcatacacagccccatctgcatagcc
tatgccccggattttgaggaaatcctcaaactggcccgtgcatatctggaatatttaggg
gaataa

DBGET integrated database retrieval system