KEGG   Treponema primitia: TREPR_2426Help
Entry
TREPR_2426        CDS       T01507                                 

Definition
endoglucanase M (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
tpi  Treponema primitia
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tpi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TREPR_2426
Enzymes [BR:tpi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     TREPR_2426
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1790293..1791318
Genome map
AA seq 341 aa AA seqDB search
MSIIALLRELCTLDGVSGMEAEVRDYIIKKAKPHAEELQVDPLGNVLVLRKGKKRPEKRV
MLCAHMDEVGFIIKDISPEGLLKFSALGGIDRRVILGKRLKVGPKKLPGVLSIKAYHLVD
KEEEKVSPKIDDLFIDIGAQSREEAEKLVSIGDICSFDSDFVEFGNGFVKAKAIDDRIGC
AVMLRLIEEEPAVDTWFAFVTQEELGLRGSPGAAFAIHPEIALILESTTAADLPSVEGHR
KSCSPGKGAVLPFMDNSAIYDHAMFDDLRRIAIEKGILWQYKTIVAGGTDAGSIQRSHEG
VQVAVIAAAVRCIHSPICIAYAPDFEEILKLARAYLEYLGE
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgagtataattgcgttgttacgggaactgtgcaccctggatggcgtttcggggatggaa
gctgaagttcgggattatatcattaaaaaggccaaaccccatgcagaggaactgcaggtt
gaccccctggggaatgtgctggtgctgcgcaagggaaaaaagcggcctgagaagcgggtg
atgctctgcgcccacatggacgaggtgggcttcattatcaaggatattagccccgaaggg
ctgcttaaattcagcgccctgggcgggatagaccgccgggttattttgggcaagcgcctc
aaggtgggccccaaaaaactccccggggttctttcgataaaggcctatcacctggttgat
aaagaagaagaaaaagtaagcccaaaaatcgacgaccttttcattgatatcggcgcccaa
agccgggaggaagctgaaaagcttgtatccatcggggatatttgtagctttgacagtgat
tttgttgaatttggcaatggctttgtaaaggccaaggccatagatgaccgcataggctgt
gccgtaatgctgcgcctcattgaagaggagccggcggtggacacctggtttgcctttgtg
acccaggaagagctgggccttaggggcagccctggggcggcctttgccattcatcctgaa
attgcccttatcctggagagcaccaccgccgctgacctgcccagtgtcgaaggccaccgc
aaatcctgttcccctggcaagggggcggtactgcccttcatggataattccgccatttac
gaccatgcaatgtttgatgatctgcgccgtattgccatcgaaaagggcatactatggcaa
tacaaaaccattgtcgccgggggcaccgacgcagggagcatacagcgtagccatgagggg
gtacaggttgccgtgatagccgcggcagttcgttgcatacacagccccatctgcatagcc
tatgccccggattttgaggaaatcctcaaactggcccgtgcatatctggaatatttaggg
gaataa

DBGET integrated database retrieval system