KEGG   Treponema primitia: TREPR_2427Help
Entry
TREPR_2427        CDS       T01507                                 

Definition
(GenBank) peptidase M42
Organism
tpi  Treponema primitia
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1789236..1790291
Genome map
AA seq 351 aa AA seqDB search
MFIEGTETMDIQKTLFELCRLWGPSGFEEKVSAHCAAILGEYTRDVKTDRLGNVLASIPC
GKTGARKVLVDAHVDEIGMIVSGIEEGFLKFETIGGVDPRMLPGREVVILTEDPLFGVVS
CLPPHVLTAEQMEKPIPVKDMFIDAGFSDEEARKRIPIGTPVVYRDEPRALENRILSGKA
MDDRAGFVALVQTLELLKGRALGVDLLVAAGAQEEVGMRGAGPLAYAVSPDYAVIVDVSH
AHTPDSKGQTSCKFGGGPSIGIGPNTDRRFTQYIRDTAVSRDIPHQLTVHTRNSGTNAFP
VQVARAGVITAMVEIPTRYMHSPVECLMIDDIENTAKLIAAVLEGMDGEGF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtttattgaaggaacagaaacaatggatatacagaaaacactgtttgaactgtgccgc
ctctgggggccctcgggatttgaagaaaaggtgagcgcccattgcgcagctattctgggt
gaatacacccgggatgtcaaaacggatcgcctgggcaatgtgctggcctccatcccctgt
ggaaaaaccggggccaggaaggtgcttgtagatgcccatgtggatgaaatcggcatgata
gtctcagggatagaagaggggttcctgaagtttgaaaccataggcggggtggacccccgt
atgctgcccggccgggaagtagtgatactaactgaggatcctctgttcggggttgtctcc
tgcctccctccccatgtgcttacggcggagcaaatggaaaaacccatccccgtgaaggac
atgtttattgatgcaggcttctcggatgaggaggcaaggaaacgcatccctatcggcacc
cctgtggtataccgcgacgaaccccgggccctggaaaaccgcatactcagcggcaaggcc
atggatgaccgggccggctttgttgccctggtacagaccctggaactccttaagggcaga
gcactgggggtagatcttctggttgctgcgggcgcccaggaagaggtgggtatgcggggg
gcaggccccctggcctacgcggtttccccggattacgcggtcatcgtggatgtgagccat
gctcacaccccggacagtaaaggccaaacttcctgcaaatttggcggcggcccctcaata
ggcattggacctaatacggatcgccgctttacccagtacatacgggacaccgcagtgtca
cgggatattccccaccagctgacggttcatacccgtaattccggtaccaacgcctttccg
gttcaggtagcccgggcaggggtcatcaccgccatggtggaaatacccacccggtatatg
cattcgccggtggaatgcctcatgatcgacgatatcgaaaacaccgccaagttaattgcc
gcagtattggaaggcatggacggggaaggattttaa

DBGET integrated database retrieval system