KEGG   Treponema primitia: TREPR_2452Help
Entry
TREPR_2452        CDS       T01507                                 

Gene name
tpiA
Definition
(RefSeq) triose-phosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tpi  Treponema primitia
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tpi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TREPR_2452 (tpiA)
   01230 Biosynthesis of amino acids
    TREPR_2452 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TREPR_2452 (tpiA)
   00051 Fructose and mannose metabolism
    TREPR_2452 (tpiA)
   00562 Inositol phosphate metabolism
    TREPR_2452 (tpiA)
Enzymes [BR:tpi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TREPR_2452 (tpiA)
Exosome [BR:tpi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TREPR_2452 (tpiA)
  Exosomal proteins of bladder cancer cells
   TREPR_2452 (tpiA)
  Exosomal proteins of melanoma cells
   TREPR_2452 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1752320..1753072
Genome map
AA seq 250 aa AA seqDB search
MSRSYYIAGNWKMHKTRAEAAELAKALVAQLKDGKHKYLVAPSFTSLETVGAIVKGTNIR
LGAQNMAAEEIGAHTGEVSVLQLKDLGVQTVILGHSERRHNYKEDNALINKKVKLALQHG
LEVILCVGELLEEREAGKAESVCETQTVKGLEGVPASELGKIVIAYEPVWAIGTGKTATP
EDADAIHAYIRKVVGKLYGDAAAENIIIQYGGSVKAENAAQLMGKENIDGALVGGAALKA
DTFVPIAKFG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagcagatcatattacattgcgggtaattggaagatgcacaaaacccgtgcagaagca
gcggaacttgccaaggccctggtggcccagcttaaagacggcaagcacaagtacctggtg
gccccgagtttcaccagcctggaaaccgtgggcgccattgtcaaggggaccaatatacgc
ttgggcgcccagaacatggccgccgaggaaattggcgcccataccggggaagtgtcggtg
ctgcagcttaaagacctgggggtacagaccgtgatcctggggcatagcgaaaggcggcat
aactacaaggaagataacgccctgatcaataaaaaggtaaagcttgccctgcagcacggc
cttgaggtgatactctgcgtgggggaactcctggaagaacgggaagcaggtaaagcagaa
tcggtctgcgaaacccagaccgtaaagggcctggagggggttcccgcttcggaacttggt
aagattgttatcgcctatgagccggtttgggccatcggcaccggcaagaccgctaccccc
gaggacgccgacgccatccacgcatatatcagaaaggttgtggggaagctttacggagac
gccgctgcggagaatattattatccagtatggcgggtccgtaaaggcggaaaatgcagcc
cagcttatggggaaagaaaacatcgacggtgccctggtgggtggcgcggcacttaaggca
gatacctttgtgcccattgccaagttcggctga

DBGET integrated database retrieval system