KEGG   Treponema primitia: TREPR_3022Help
Entry
TREPR_3022        CDS       T01507                                 

Definition
Xaa-His dipeptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
tpi  Treponema primitia
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tpi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TREPR_3022
  Amino acid metabolism
   00300 Lysine biosynthesis
    TREPR_3022
Enzymes [BR:tpi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     TREPR_3022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1146850..1148304)
Genome map
AA seq 484 aa AA seqDB search
MNRSKTGEELDGALDTWILNKRRELIEDIKTLVRIPSISAAPNGKYPFGEPCGAVVDSME
GLIRKHGLGVKSYDYYGIGALYGKDTAERLSSNSIGFFSHLDVVPPGDGWTGSPFEGREQ
DGFIIGRGATDNKGPAVAVLYTLKFLQDQGIVLKHGLYAFFGCNEEAGMQDIAHFLEVDN
PPAFGLVSDSSFPVCNGEKGILTADFVANLGEGNLVRFEGGTVSNMVPNYASVELRGIGA
EEARAVLGSDFTVEALEGSGQPGGALVRISARGISGHAAFPENSVNALQKLAAGILKANL
AQGDAVPALTFVADSFADYYGEGLNIAFEDELSGKTTHVGSTGATREGKLIIGINVRYAI
TSPQEELVERLRQRGAAYGYTLEKIHNRPPCYTPADDPLVIALNDIANRHLGTDLKPFVM
GGGTHARRLPRAVGYGPERRDIPSPFGPLEGKAHQVNEAVSVASLEEAIHIYVQAILKLD
ELLS
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgaatagatcgaagaccggagaagaattagacggggcgttggatacatggatactaaat
aaacggcgcgaattgatagaagacattaagaccctggtacggattcccagtatatccgcc
gccccaaacgggaaatacccctttggggaaccctgcggcgccgtagtggatagtatggaa
gggctcattcgcaaacatggattaggggtaaaatcctacgattattatggcatcggcgcc
ctttatggaaaagataccgctgagcggctttcctccaattccatcgggtttttttcccat
cttgatgtggtgcccccgggagacggatggacaggatcgccctttgaagggcgggagcag
gatgggtttattataggccggggggctacggacaataaggggcccgcagtagcagtgctc
tataccctcaaatttttacaggaccagggcatagttcttaaacacgggctttatgctttt
tttggctgtaacgaagaggcgggaatgcaggatatagcccattttctcgaagtggataac
ccgccagcctttgggctggtctcggatagcagttttcctgtttgcaacggggagaagggc
atacttaccgccgattttgtcgccaatctgggggagggaaatctggtacgatttgaggga
gggaccgtgtccaacatggtacctaactatgcctctgtggaattacgtggtatcggcgcc
gaagaagcccgggcggtgttgggatccgattttactgtggaggcccttgaaggaagcggg
caaccgggaggagctttggtgcggataagcgcccgggggatcagcggccacgcagcgttt
ccggaaaattcggtaaacgcccttcaaaagctggcggcgggtatcctcaaagcaaatctg
gcccagggcgacgccgttcctgccctgacctttgtggcggattcctttgcggactattac
ggcgaaggcctcaatattgcctttgaagacgaattatccgggaagaccacccatgtgggc
agtactggggcaaccagggagggcaaacttatcatcgggattaatgtgcgctatgccatt
acaagcccccaggaagaactggtggaacggctgcggcaaagaggagcggcctacggctat
accctggaaaaaattcacaatcgccccccttgctataccccggcggatgatcccctggta
atagccttaaacgatattgcaaaccgccatttgggcactgacctaaagccctttgtcatg
ggcgggggtacccatgcccgcaggctgccccgggcggtgggctatggccctgaaagaagg
gacatcccctcccccttcgggcccctggaggggaaggcccatcaggtgaacgaggcagtt
tccgttgcctccctggaggaggccatccatatttatgtccaggctatactgaaactggat
gaactgcttagctaa

DBGET integrated database retrieval system