KEGG   Treponema primitia: TREPR_3303Help
Entry
TREPR_3303        CDS       T01507                                 

Definition
(GenBank) peroxiredoxin Hyr1
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
tpi  Treponema primitia
Pathway
tpi00480  Glutathione metabolism
tpi00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:tpi00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    TREPR_3303
  Metabolism of other amino acids
   00480 Glutathione metabolism
    TREPR_3303
Enzymes [BR:tpi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     TREPR_3303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AEF86820
UniProt: F5YKB2
Position
854751..855281
Genome map
AA seq 176 aa AA seqDB search
MNLYDFTVTNREGKPVSLADYKGKALLIVNTATKCGLTPQYEGLQKLYKAYHDRGFEILD
FPCNQFGEQAPGSAEEIAEFCTIKYHATFPQFAKIDVNGDKAAPLFTYLKEQVAETEDEG
AAALKERLKGRTPFTGPKDIKWNFSKFLVSRDGRVTAWFFPTYSPEKLSSAIEGLL
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgtatgattttaccgtaacgaaccgcgaaggaaaaccggtttctcttgccgat
tataaggggaaagcgcttttgattgtgaatactgccaccaaatgcgggttgacgccgcaa
tatgagggtttgcaaaaactgtacaaagcctatcacgacaggggatttgaaattttagac
tttccctgtaatcaattcggcgaacaggccccgggcagcgccgaggaaattgccgagttc
tgcactataaagtatcacgctacctttccccagtttgccaagattgatgtaaatggcgat
aaagcggcgcctctttttacgtatctcaaagagcaggttgcggaaaccgaagatgaaggg
gcggcggctctcaaggaacggcttaaagggcgcactcctttcaccggtcctaaagacatc
aaatggaatttttccaaatttcttgtcagccgtgatggcagggtgactgcatggtttttc
ccaacctatagccctgagaaattgtcttctgcaattgagggattgctttag

DBGET integrated database retrieval system