KEGG   Treponema primitia: TREPR_3303Help
Entry
TREPR_3303        CDS       T01507                                 

Definition
peroxiredoxin Hyr1 (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
tpi  Treponema primitia
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:tpi00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:tpi00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
854751..855281
Genome map
AA seq 176 aa AA seqDB search
MNLYDFTVTNREGKPVSLADYKGKALLIVNTATKCGLTPQYEGLQKLYKAYHDRGFEILD
FPCNQFGEQAPGSAEEIAEFCTIKYHATFPQFAKIDVNGDKAAPLFTYLKEQVAETEDEG
AAALKERLKGRTPFTGPKDIKWNFSKFLVSRDGRVTAWFFPTYSPEKLSSAIEGLL
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgtatgattttaccgtaacgaaccgcgaaggaaaaccggtttctcttgccgat
tataaggggaaagcgcttttgattgtgaatactgccaccaaatgcgggttgacgccgcaa
tatgagggtttgcaaaaactgtacaaagcctatcacgacaggggatttgaaattttagac
tttccctgtaatcaattcggcgaacaggccccgggcagcgccgaggaaattgccgagttc
tgcactataaagtatcacgctacctttccccagtttgccaagattgatgtaaatggcgat
aaagcggcgcctctttttacgtatctcaaagagcaggttgcggaaaccgaagatgaaggg
gcggcggctctcaaggaacggcttaaagggcgcactcctttcaccggtcctaaagacatc
aaatggaatttttccaaatttcttgtcagccgtgatggcagggtgactgcatggtttttc
ccaacctatagccctgagaaattgtcttctgcaattgagggattgctttag

DBGET integrated database retrieval system