KEGG   Treponema primitia: TREPR_3492Help
Entry
TREPR_3492        CDS       T01507                                 

Definition
pyrazinamidase/nicotinamidase (EC:3.5.1.- 3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
tpi  Treponema primitia
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tpi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    TREPR_3492
Enzymes [BR:tpi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     TREPR_3492
    3.5.1.-  
     TREPR_3492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
670612..671352
Genome map
AA seq 246 aa AA seqDB search
MAIDIRESALIIVDVQNDFCPAYTGKDGKTQPTGALAVARGCDVVEPLNLAAEKFYFGQG
KIVVSQDWHPAHHSSFASSHPGKKVNESILLPVPEPFRGEHERDAKNEYVPAAIQQILWP
DHCVQGSQGAMLHPDLDLDHVDLIIRKGCRKDLDSYSVFFENDRYTPTGLDGFLKGLGIT
QVFIGGLATDYCVLYSVMDAIRLGYRTVILSDAVSGVGVPEGSVEQAFSLMKGAGVSFIT
TKEIPG
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgacattagggaatccgctctgattatcgtagatgtgcagaatgatttttgc
cctgcctataccggaaaagatgggaagacccagccaaccggggctctggcagtggcccgg
ggctgtgatgtggttgaaccccttaacctggcggcggaaaagttttatttcggacaggga
aagatcgtcgtctcccaagactggcatccggcccatcatagttccttcgcctcctcccat
ccgggcaaaaaagtgaacgagtctatactccttcctgtaccggaacccttccggggggaa
catgaacgggatgctaaaaatgaatatgtccctgcggcaatccagcagattctgtggccg
gatcactgtgtccagggcagccagggcgccatgttgcaccctgatctcgacctggaccac
gttgatctgatcatccgtaagggctgccgcaaggacctggattcctattcggtatttttt
gaaaatgaccggtacacccccacaggcctggacgggtttttgaaaggcctgggaattacc
caggtctttatcggggggctggccacagactactgcgttctctacagtgtcatggatgca
atacgcttggggtacaggacggtgatcctttccgatgcggtgagcggggtaggcgtaccc
gaaggttcggtggaacaggcctttagcctgatgaagggggcaggagtctcctttattact
accaaggagataccaggatga

DBGET integrated database retrieval system