KEGG   Treponema primitia: TREPR_3551Help
Entry
TREPR_3551        CDS       T01507                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tpi  Treponema primitia
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tpi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TREPR_3551
   01230 Biosynthesis of amino acids
    TREPR_3551
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TREPR_3551
   00030 Pentose phosphate pathway
    TREPR_3551
   00051 Fructose and mannose metabolism
    TREPR_3551
   00052 Galactose metabolism
    TREPR_3551
  Energy metabolism
   00680 Methane metabolism
    TREPR_3551
Enzymes [BR:tpi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TREPR_3551
Protein phosphatases and associated proteins [BR:tpi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TREPR_3551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(613376..614479)
Genome map
AA seq 367 aa AA seqDB search
MAAVEQSATKTFGILTAGGDCPGLNAAIRGVCRAAHDRYNMTAVGIANGYRGLIDEDWRI
LRPVDFMGILTRGGTILGASREKPFKARPKEYSSDIEEDKVELIKENYRKLNLDCLVVLG
GNGTNTTGYLLAKEGLNVLGLPKTIDNDIIGTDRTFGFHSALSIATEAIDRLHSTAQSHN
RVMIIELMGHKAGWLALYAGIAGGGDVILIPEIPYDIKAIGRHLEKRTQSGRGFSIVVVA
EGAMSIEEAAMDKKERKKYREQTVVPSIGYRIAGEIEAETGLETRATVLGYVQRGGIPSA
SDRVLATSLGTAAAKLLAKGEYGRMVALKGESISSVDLRVPAEGVKTVPQDHYMIDTAIS
VGTCMGV
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggcagccgtagaacagagtgcgacaaaaaccttcgggatccttaccgcagggggggat
tgcccgggactgaacgccgccatccggggtgtgtgccgggctgcccacgacaggtacaac
atgaccgctgtgggtatcgccaatggctaccggggcctcatcgacgaggactggcgcata
ctgcggccggtggactttatggggatcctcacccgggggggcaccatcctgggggccagc
cgggaaaagccctttaaggctcggcctaaggagtacagcagcgacatcgaggaagacaag
gtagagctgattaaggaaaactaccggaaactgaacctggattgcctggtagtcctgggg
gggaacggcaccaataccacgggctacctcctcgccaaggaggggctgaatgtcctgggg
ctcccaaaaaccatcgacaatgatattatcggcaccgaccgaacctttggcttccactca
gccctgtccatcgccaccgaggccatagaccggctccattccaccgcccagagccataac
cgggtgatgatcattgagcttatgggccacaaggcgggttggctggcgctctacgcgggg
atagccggcgggggggacgtcatcctgataccggaaatcccctacgacattaaggccata
ggccgccacctggaaaaacgtacccaaagcggcaggggcttttccatcgtggtagtagcc
gagggggccatgtcgattgaggaagcggcaatggacaaaaaggaacgaaagaaataccgg
gaacaaactgtggttccatccataggctaccggatagccggggaaattgaggccgaaacg
ggcctggaaaccagggcaacggtgctgggctatgtgcagcgagggggcatacccagcgcc
tccgatcgggtcctggccaccagcctgggaaccgccgcggcaaaacttctggccaaaggc
gaatacggcaggatggtcgccctgaaaggggaatccataagctccgtagatctcagggtc
cctgcggaaggggttaaaaccgtcccgcaggatcattatatgatcgataccgcaatttca
gtgggaacctgcatgggagtataa

DBGET integrated database retrieval system