KEGG   Treponema primitia: TREPR_3780Help
Entry
TREPR_3780        CDS       T01507                                 

Gene name
purN
Definition
phosphoribosylglycinamide formyltransferase (EC:2.1.2.2)
Orthology
K11175  
phosphoribosylglycinamide formyltransferase 1 [EC:2.1.2.2]
Organism
tpi  Treponema primitia
Pathway
Purine metabolism
One carbon pool by folate
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:tpi00230]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:tpi00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
399488..400099
Genome map
AA seq 203 aa AA seqDB search
MNILVLVSGGGTNLQALIDAERAGRLGPGKIVAVISDCRSAYALERARAAGIPALIEAPD
RGLPEDTRLPELSDRILRRARELDAGLIILAGFLSILGGELIGAYAGRIINLHPSLLPKF
GGPGMYGEHVHRAVLAAGETESGCTVHLVDAGTDTGTILLQRKVPVLSGDTQDTLAARIH
KEEHIAIVEVAALMAKKLNTLAG
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgaatatccttgtcctggtttccggggggggtaccaacctccaggccctgatcgatgcg
gaacgggccggccggctggggccggggaaaatagttgcggtgatttcagattgccggtca
gcctatgccctggaacgggccagggctgcagggattcctgccctgatcgaagcgccggac
agggggctcccggaagatacgcggcttccggaactttcggatcggatacttcgccgtgcc
cgggaactggatgcgggcctgattatcctggcggggttcctctccatacttgggggggag
cttatcggagcctatgctggaaggatcatcaacctgcacccgagcctgctgcccaaattc
ggcgggccgggcatgtacggggaacatgtccaccgggctgttttggctgccggggaaacg
gagtcggggtgtacggtgcatctggtggacgccgggaccgacaccgggactattttactg
cagcggaaggttccggttctgagcggggatactcaggataccctggcagcgcggatccac
aaagaagaacatatcgccattgtcgaggtcgcggccttgatggcgaaaaagttaaatacc
cttgccggataa

DBGET integrated database retrieval system