KEGG   Treponema paraluiscuniculi: TPCCA_0108Help
Entry
TPCCA_0108        CDS       T01555                                 

Gene name
pfk
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tpl  Treponema paraluiscuniculi
Pathway
tpl00010  Glycolysis / Gluconeogenesis
tpl00030  Pentose phosphate pathway
tpl00051  Fructose and mannose metabolism
tpl00052  Galactose metabolism
tpl00680  Methane metabolism
tpl01100  Metabolic pathways
tpl01110  Biosynthesis of secondary metabolites
tpl01120  Microbial metabolism in diverse environments
tpl01130  Biosynthesis of antibiotics
tpl01200  Carbon metabolism
tpl01230  Biosynthesis of amino acids
tpl03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:tpl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TPCCA_0108 (pfk)
   00030 Pentose phosphate pathway
    TPCCA_0108 (pfk)
   00051 Fructose and mannose metabolism
    TPCCA_0108 (pfk)
   00052 Galactose metabolism
    TPCCA_0108 (pfk)
  Energy metabolism
   00680 Methane metabolism
    TPCCA_0108 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    TPCCA_0108 (pfk)
Enzymes [BR:tpl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TPCCA_0108 (pfk)
Protein phosphatases and associated proteins [BR:tpl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TPCCA_0108 (pfk)
Messenger RNA biogenesis [BR:tpl03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     TPCCA_0108 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: AEH40063
UniProt: F7XRB3
Position
complement(122219..123604)
Genome map
AA seq 461 aa AA seqDB search
MAHLPKEYDFSIESLGESKIPSPIYLSHTLGDFIPNYVSDNEYISHELSAHLGETVGPFT
HKNLMERAGPRQKIFFNPHHVHAGIVTCGGLCPGLNDVIRAIVRCLWGRYGVKRISGIRF
GYKGLLPDYNFDILPLTPEVIDNCHKTGGSLLGTSRGGGNRVVDIVDGIERLNLHILFII
GGDGSQKGAKEIADEIKHRNLKISIIGIPKTVDNDISFVQKSFGFDTAIVKATEAVAAAH
MEARSQINGIGLVKLMGRESGFIATYTAIASHETNFVLIPEVSFDLDGPNGLLAHLEKRI
ALRKHAVLVVAEGAGQDLMVNADGVPSGDSQGGSLRVSSGTDASGNKRLADIGLFLKEKI
EVYFKEKRIHTNLKYIDPSYLIRSAVAAPIDSIYCERLGNNAVHAAMCGKTKMIIGLVHN
KFVHLPIDVVVCQRKHVNPEGSLWRDALDATGQPIVMKNII
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggcacatcttcctaaagagtacgatttttctatagagtcattgggggagagcaaaatt
ccctctcccatctacctgtctcacacccttggcgacttcattcctaactacgtcagtgac
aatgagtacatcagccatgaactgagtgcgcatctgggggagacggtagggccctttact
cataaaaacttgatggaacgtgcgggcccgcgccagaagattttcttcaacccgcatcac
gttcatgcaggtattgtcacctgtggagggctctgtcccggactcaacgatgtcattcgc
gccatcgtccgctgcctttggggccgctatggcgttaagcgcattagtggtatccgcttt
ggctataagggcctcttgcccgattacaacttcgatatcctgccgctcacccctgaggtc
atcgataactgccacaaaacaggtggttcgctgctaggcacctcgcgcggtggggggaac
cgtgtggttgacatcgtcgatggtatcgagcggctcaacctgcacattctctttatcatt
gggggggatggcagtcagaagggagcaaaagagattgccgacgaaataaaacaccgcaac
cttaagatttccatcatcggcattcccaaaacggtggacaacgacatctcttttgttcaa
aagtcatttggcttcgatactgctattgtcaaagcaacagaggcagttgccgcagcgcac
atggaggctcgttcacagattaacggcattggactggtcaaactcatggggcgtgagtct
ggattcatcgctacgtacacggcgattgcgagccatgagacaaacttcgtactcatccct
gaagtgagctttgaccttgacggtccaaatgggcttttggctcacctagagaagcgaatc
gcgctacgtaagcatgcggtgctcgttgtagcagaaggtgcggggcaagacctaatggta
aatgcggacggtgtgccctccggtgattcccaaggaggtagtttgcgcgtgagcagcggc
acggatgcgtcgggtaacaagcgccttgcggatatcggtttgttcttaaaagaaaagatt
gaagtctatttcaaagaaaagcgtatacacaccaatttaaagtacatcgatccgagctac
ttgattcgttccgcggttgctgcgcccatagattcgatttactgcgaacgcctcggtaac
aatgcggtgcatgcggcgatgtgcggtaaaacgaaaatgatcattggcttggtgcacaat
aagtttgtacacctcccaatcgatgtggtggtgtgccaacgcaaacacgtaaatcctgaa
ggatcgttgtggcgcgacgcccttgatgcaacaggacagccgattgtgatgaaaaatatt
atctag

DBGET integrated database retrieval system