KEGG   Treponema paraluiscuniculi: TPCCA_0631Help
Entry
TPCCA_0631        CDS       T01555                                 

Gene name
cheB
Definition
protein-glutamate methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
tpl  Treponema paraluiscuniculi
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:tpl02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:tpl02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
683779..684990
Genome map
AA seq 403 aa AA seqDB search
MKNTNDIAVLIVDDSALMRKVIGKVIEGAPGLSIAGKAMNGRFALDMLERVQPDVILLDL
EMPHMNGLQFLEQRKRLRIDIPVIILSSIAKEGARVTMQCLELGASDFVTKPFGSESAHL
RTVSRKIVDYVTAYGRRYKLLRRTRRCLAMDTPVERPAGEEDLNCLDTQERASLPSVCAR
APARDRASYTITPTEGARQTRIVPLRESGALQIIAIGVSTGGPSALRHIFAQLDADLPQP
VVVVQHMPAGFTREFAYSLNQVCALEVKEAQEGDLVRRGRVLIAPGDHHLTVERRSLATV
AHINSDEPENGHRPSVDVLFESVARHFENRALGILMTGMGRDGAAQLARLYTEGSRTIAQ
DADSCIVYGMPRVACELGAVGEQVSLDDMAATINRYGKVFASS
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatactaatgatattgctgttttaatcgtggacgattctgcgctcatgagaaag
gttattggaaaagtcattgaaggagcgccgggtcttagcatagcgggcaaggccatgaat
gggcgctttgcgcttgacatgctagagcgtgtacagccagatgtcatcttgctcgacctg
gaaatgccgcacatgaacgggcttcagtttcttgaacagcggaaacgtctacgcattgat
attccagtaatcattctctctagcattgcaaaagaaggtgcacgagtcacgatgcaatgt
ttggagctgggggcaagtgactttgtcaccaagccttttggatctgagtctgcgcatttg
cgcacggtttcgcgcaagattgtcgattacgttaccgcgtatgggagacgctacaagttg
ctgcgtcgcacgcgccgctgtcttgccatggacacacctgttgagagacctgccggcgag
gaggacttgaattgtttagatacccaagagcgagcctctctgccgtctgtatgtgcacgt
gcacccgcgcgtgaccgtgcatcctacacaatcacccccacagagggagcgcgccaaacg
cgcatcgtgccactgcgtgaaagtggggcactgcagatcattgcaatcggtgtatcaacg
ggaggacctagcgcgctgcgtcatatctttgcacagctcgatgcagatttgccgcagccg
gtggtagtagtgcagcacatgcctgcaggtttcacgcgtgaatttgcgtacagtcttaac
caggtatgtgcgctggaagtaaaagaagcgcaagaaggagacttggtgcggcgtgggcgt
gttttgattgcccccggggatcaccatctgacggtagagcggcgctccctggcaactgtt
gcgcacatcaactcggatgaaccggaaaacggtcaccgacccagcgttgatgtgttattt
gagtcagtagctcgccattttgaaaaccgcgcattgggaattttaatgacaggaatggga
agggacggtgccgcgcagcttgcgcgtttatacacagaaggctcgcgtacaattgcgcag
gacgcagattcgtgcattgtatatggaatgccgcgtgtagcctgcgaacttggagcagtt
ggcgaacaggtgagtcttgatgatatggcagcgacaataaatcgctacggcaaggtgttt
gcctcttcctga

DBGET integrated database retrieval system