KEGG   Treponema paraluiscuniculi: TPCCA_0902Help
Entry
TPCCA_0902        CDS       T01555                                 

Definition
putative esterase/lipase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
tpl  Treponema paraluiscuniculi
Brite
Enzymes [BR:tpl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     TPCCA_0902
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(978976..979857)
Genome map
AA seq 293 aa AA seqDB search
MWPIVAAQRVTIQETRAVLAARFLFTFCCFFTTLARYLLMAEHTSCTSIHPLVRSAFYAG
GAHAVLLIHGYMGTPREMQFLGRALHRDGFTVSIPRLPGHGTNREDFLETGWRDWLRRVC
DEYRDLSAAYPSVSVGGLSMGGVLTALVAARFCPQKAFFCAPGFAVSDWRIKLSPLVRWF
VREFAADADPFYPEQDFNDATKDYRSAHYIAQVAQFYALQRRAIRSLACIRSTLLTILSR
QDPLVPCAAVQKLLDARVRSAHQYVVLEHSGHVITDDVEREQVASCVSAFLRT
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgtggccgattgtagccgcgcaacgcgtgacaatacaagagacgcgtgcggtgctcgcg
gcacggtttctctttactttttgttgcttttttactaccctcgcgcgctatctgcttatg
gctgaacatacttcctgtacgagcattcatccccttgtgcgcagcgcgttttacgccggg
ggtgcgcatgcagtactgcttattcatggatacatgggcaccccgcgcgagatgcagttt
ttaggtcgtgcgctccaccgggacggctttacggtctctattccccgtttacctggtcac
ggtacgaatagagaggattttcttgagaccgggtggagggattggctgcggcgcgtgtgt
gatgagtaccgtgacctttccgctgcgtacccttcggtatctgtgggggggctgtccatg
ggaggtgtgctgactgcactcgtggcggcgcgtttttgtccccagaaagctttcttttgt
gcaccgggttttgcagtttctgattggaggataaagctgtctcctctagtcaggtggttt
gtgcgtgagtttgctgcggacgcggatcccttctaccccgagcaagactttaatgacgcc
acaaaggattaccggagtgcgcactacattgcccaggtggcgcagttttatgcactgcaa
agacgtgcgatccgttcactggcgtgcattcggagtacgttgttaacgatcctgtctcgg
caggacccattggtgccgtgtgcagcggtgcaaaaattactcgatgcgcgtgtgcgcagc
gcacaccagtacgtagtgctcgagcacagtggtcacgtgatcactgatgacgtggagcgg
gagcaggttgcctcttgtgtcagtgcttttttacgcacgtag

DBGET integrated database retrieval system