KEGG   Treponema pallidum subsp. pertenue SamoaD: TPESAMD_0029Help
Entry
TPESAMD_0029      CDS       T01751                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
tpm  Treponema pallidum subsp. pertenue SamoaD
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:tpm00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:tpm00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
36829..38193
Genome map
AA seq 454 aa AA seqDB search
MGPYFCGIRAIKLYVDRCSTGMCAQRGESMSCYRVEGGFPVSGCIRVCGNKNAALPCIAA
AVLTQEPVLLQNVPDIEDVAVMLTIFRAFGGSVERRGNHEYMLHLPQLQTCEVPCEAAQK
VRASILFAGPLLARGRKAVLPPPGGDVIGRRRLDTHFLALAALGAQVRLDGVFTFSANKL
VGCDVFLDEASVTATENVLMASVLAEGVTVITNAASEPHVQDLCHLLNAMGARVSGIGSN
VLTIEGVSALHGTTYTLGADFMEVGSLIGLAVVTRGALTISDVNVRDLRPLGFAFKKLGV
IWSEQEHAVSVSASQDLRVNYDFGGMIPKIDDGPWPAFPPDLTSIMTVVATQVEGVILIH
EKMFESRMFFVDKLITMGARIILCDPHRALVSGPSALHGSDLVSPDVRAGMAMVLAACCA
RGVSIIRNVYQIERGYERLVERLQAIGVRIWKES
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggggccgtacttttgcggtattcgtgcaattaagttgtatgttgatcggtgttctaca
ggaatgtgtgcgcaaaggggtgagagcatgagttgctatcgtgttgaaggtgggtttccc
gtttcaggttgtattcgcgtgtgtggaaataagaatgcagcgcttccctgtattgcggcg
gcagttctcacacaagagccagtgttactgcaaaatgtgcccgacattgaggatgtggcg
gtgatgttaactatctttcgtgcgtttggtgggagtgttgaaaggcgtggtaatcatgag
tacatgttacatcttcctcagttacagacgtgcgaagtgccgtgcgaggctgcgcagaaa
gtgcgtgcttccattctttttgcagggccacttcttgcgcgtggtagaaaagcagtgctt
ccaccacctggtggtgatgttattgggcgcaggagacttgatacgcattttcttgcgctt
gccgcacttggcgcacaagttcgtttagatggggtgtttactttctctgcaaataagctg
gtgggatgtgatgtcttcttagacgaggcatctgtgacggcgacagagaatgtgcttatg
gcttcagttcttgccgagggggttacggtaatcacgaacgcggcgagcgaaccgcatgtg
caagatctatgccatttgttgaatgcgatgggtgcgcgcgtctctggcatcggatcgaat
gttttaacaattgagggggtgagcgcgttgcatggtaccacatatacacttggggctgat
ttcatggaagtaggttcgcttattgggcttgcggtagtaacgcgtggagcattgacgatt
tcggatgtgaacgtacgtgatctacgtccactaggttttgcgtttaaaaaacttggagta
atttggagcgagcaagagcacgcggtaagcgtctctgcgtcgcaggatctgcgggtaaat
tacgattttggcggtatgattcctaaaatagatgatggcccgtggcctgcatttccgccg
gatctgactagcattatgacagtggtggcgactcaagtcgaaggggttatattgattcat
gagaaaatgtttgagtcgcgtatgttttttgtggacaagttaattaccatgggtgcgcgt
atcatcctgtgtgacccgcatcgggcgcttgtttcaggtccgagtgcattgcatgggagt
gacctggtatctcctgatgtgcgtgcgggaatggcgatggtgcttgcagcgtgttgtgcg
cgcggggtaagtataatccgtaacgtgtatcaaattgagcgtggatatgaacgtctagtg
gagcgtttgcaggcaattggtgtccgtatttggaaagagagttga

DBGET integrated database retrieval system