KEGG   Treponema pallidum subsp. pertenue SamoaD: TPESAMD_0351Help
Entry
TPESAMD_0351      CDS       T01751                                 

Gene name
proB
Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
tpm  Treponema pallidum subsp. pertenue SamoaD
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:tpm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TPESAMD_0351 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    TPESAMD_0351 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    TPESAMD_0351 (proB)
Enzymes [BR:tpm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     TPESAMD_0351 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
377275..378165
Genome map
AA seq 296 aa AA seqDB search
MIRALFAAAKKIVIKIGSNTLAQADGTPDEEFLAECARACAALMRDGKQIVVVSSGAQVA
GISALHCLSSPPQGAGLERHESRGVIPGDGASCKQALCAVGQAELISRWRSAFAAHQQCV
GQFLCTKEDFTDSDRAAQVRYTLSFLLERRVVPILNENDALCCSDVPSVPADRRVSLSPQ
KRIGDNDSLSAFVALLWQADLLLLLSDIDGVYDKDPKAHTDAQHVPLVTDVSALVGKTSM
GSSNVFGTGGIATKLDAARLVTRAGIPLVLANGRHPDPILSLMRGDARGTLFVPVS
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
gtgatccgtgcgctttttgctgcggcaaaaaaaattgtgataaagattgggtcaaatacg
cttgcgcaggcagatggtactcctgatgaggagtttttggcggagtgtgctcgcgcctgt
gcggcgctgatgcgtgacggcaagcagatagttgtggtgtcgtctggcgctcaggttgca
gggatttctgcgctccattgcctttcatctcctcctcagggggcgggtttagagcgtcac
gaatcgcgcggcgttattccgggtgatggtgcgtcctgcaaacaggcgttgtgtgcggtg
ggtcaggcggagttgataagtcgttggcgttctgcgtttgcagcgcaccagcagtgcgtg
ggccagtttctgtgtacgaaggaggattttactgactcggaccgcgcggcgcaggtacgc
tacacgttgtcctttttgctcgagcgcagggtagtacctatccttaatgaaaatgacgcg
ctctgttgcagcgacgtcccctctgtacccgccgaccggcgggtgtccctatcacctcaa
aaaaggattggagataatgacagtctgtccgcgtttgtagcgctgttgtggcaggcagat
cttttgcttttgttgagtgacattgacggcgtgtatgacaaagacccaaaggcacacaca
gatgcgcagcacgttcctctggtgacggacgtgtcagcgcttgtgggtaaaacgagcatg
ggttcttccaatgtctttggtacgggtgggattgctacaaagctggatgctgcgcgtctt
gtcacgagggcgggaattcctctggtgctggcaaacgggcgccatccggatccgatcctg
agccttatgcgcggggatgcgcgggggacacttttcgtgcctgtttcttag

DBGET integrated database retrieval system