KEGG   Treponema pallidum subsp. pertenue SamoaD: TPESAMD_0371Help
Entry
TPESAMD_0371      CDS       T01751                                 

Gene name
ispE
Definition
4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
tpm  Treponema pallidum subsp. pertenue SamoaD
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:tpm00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
396132..397007
Genome map
AA seq 291 aa AA seqDB search
MQSLSLRAHAKVNMHLWVGARRADGLHSIESVMQRITLADSLSLSRLDIPGRCEVCSPYM
ALPRENTLTRAYARFCQVTGVHDGVRVRVVKRIPAGSGLGGGSADAAALLCGLDTLFGTT
LSARVLREVAYSVGSDVPFFLASQAACVLGGGEQLVPLVPKTGYLGLLVWPGLHSGSAQA
YEDLDRLRACGVHAADGEQYSLRGATALSAHYAQDCARWRFFNSLDTPVQRRYPVVALAR
WDLARAGACFTAMSGSGSAVFGLYRDEEELRRAHKLLAKRWCWCVRVRLCG
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
gtgcagtcactgagtttgcgcgctcacgcaaaggtgaacatgcatctgtgggttggtgca
cgtcgggccgatggtcttcactcgattgagagtgtaatgcagcgcattacgcttgcggat
tctttgtctctttcgcgcctggatatccctggccggtgtgaggtgtgttcgccttatatg
gctctgcctcgagaaaacacgctgacccgtgcgtatgcgcggttttgtcaggtaactggc
gttcacgatggtgtgcgcgtgcgcgtagtgaagcgtatccctgcagggtctggacttggt
ggggggtctgctgatgctgccgcgcttttgtgtggccttgatacgttgtttgggacgacc
ctttctgctcgggttctacgagaagtggcgtatagtgtcggcagtgatgtcccttttttc
ctggcttcccaggctgcgtgcgtgctaggtggtggtgagcagctcgttcccctcgttcca
aagactggctatctggggcttttggtctggccgggattgcacagcggttctgcacaggcc
tatgaggatttggacaggttgcgtgcgtgcggcgtacatgctgccgacggcgagcagtac
tctctgcgtggggctaccgcgctttctgcgcactatgcacaggattgtgcgcggtggcgg
ttttttaatagcttagatacccctgtacagcgtcggtaccctgtagtcgcccttgcgcgt
tgggatctggcccgtgcgggtgcgtgctttacagcgatgagtggaagcgggagcgcggtt
tttggtctgtatcgggatgaggaggagcttcggcgcgcgcataagctgcttgcaaagcgg
tggtgttggtgtgtgcgtgtccggttatgtgggtag

DBGET integrated database retrieval system