KEGG   Treponema pallidum subsp. pertenue SamoaD: TPESAMD_0537Help
Entry
TPESAMD_0537      CDS       T01751                                 

Gene name
tpiA
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tpm  Treponema pallidum subsp. pertenue SamoaD
Pathway
tpm00010  Glycolysis / Gluconeogenesis
tpm00051  Fructose and mannose metabolism
tpm01100  Metabolic pathways
tpm01110  Biosynthesis of secondary metabolites
tpm01120  Microbial metabolism in diverse environments
tpm01130  Biosynthesis of antibiotics
tpm01200  Carbon metabolism
tpm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tpm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TPESAMD_0537 (tpiA)
   00051 Fructose and mannose metabolism
    TPESAMD_0537 (tpiA)
   00562 Inositol phosphate metabolism
    TPESAMD_0537 (tpiA)
Enzymes [BR:tpm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TPESAMD_0537 (tpiA)
Exosome [BR:tpm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TPESAMD_0537 (tpiA)
  Exosomal proteins of bladder cancer cells
   TPESAMD_0537 (tpiA)
  Exosomal proteins of melanoma cells
   TPESAMD_0537 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEZ57659
Position
complement(580580..581329)
Genome map
AA seq 249 aa AA seqDB search
MRGYFIAGNWKMHKTCAEAVALAQELVRELRGGPHTYMIAPSFTALDAVGKVLRGSNVLL
GAQDVSSEEWGAHTGEVSVLQLEDLGVQVVIVGHSERRHGRGENDKLINQKVRRVLESGL
RVILCVGERLQEYEAGCTNEVVGTQVRAGMADVCGSLMHNVTVAYEPVWAIGTGKTATPA
QANAVHAHIRSVVREMYGAAIAEALCIQYGGSMKAENARALLAEEHIDGGLIGGASLEAA
SFVPIARSV
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggctattttatcgcggggaattggaagatgcataaaacgtgtgcggaggcggtg
gcgcttgcgcaggaactcgtgcgggaattacggggtggtccgcacacatacatgattgcg
ccgagttttaccgctttagacgcggtggggaaggtgctacggggaagtaacgtacttctt
ggcgcgcaggacgtgagtagtgaagagtggggggcgcatactggagaggtatccgtcctt
caactcgaagacctgggggtacaggtagtcatcgtggggcattccgaacggcgtcatggg
cgtggggagaatgataagcttatcaatcaaaaggtcagacgcgtgttagaaagcggtttg
cgcgtcatcttatgcgtcggcgaacgactccaagagtatgaagcggggtgtaccaacgag
gtagtgggaactcaagtgcgcgcagggatggcagacgtgtgtgggtcactcatgcataat
gtaactgttgcgtatgagcctgtgtgggcaattggtacgggtaagactgccactccggca
caggcgaatgcggttcatgctcatattcggtcagtagtccgcgagatgtacggcgcggct
atcgcagaggcactgtgtattcaatacggcggatccatgaaagcggagaacgcgcgggca
ctgttggctgaagagcacattgacgggggactcattggcggtgcttcgctggaggctgcg
tcttttgttcctatcgcgcgcagcgtgtag

DBGET integrated database retrieval system