KEGG   Treponema pallidum subsp. pertenue SamoaD: TPESAMD_0601Help
Entry
TPESAMD_0601      CDS       T01751                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
tpm  Treponema pallidum subsp. pertenue SamoaD
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:tpm00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(654514..655644)
Genome map
AA seq 376 aa AA seqDB search
MSVRRVVVLGITGSIGAAALKLLRRFPDRFLLVGASGHRQTEYARALAREFSLSDITMTG
SCSEQEGRARIKRLLSSCEAEVVVNGIAGAAGLFASLEVLKTRCTLALANKESVVLAASL
LHAAARESGATIVPVDSEHAAIFQLIAAHGAHAVAQVVLTASGGPFRTFSKECLAHVTVE
DALQHPTWRMGKKISVDSATLANKALEVIEAVQFFRIPVDRVTVVVHPQSIVHALVQCHS
GETYAQLSVPDMASPLLYALLYPDAPPAYQTPLDFTSGLSLHFEPPRVDDFPLLRMGFDV
ARAQRAYPIAFNAANEEAVRAFLQRNIGFLDIAHVTAQALQEDWRAIPQTFEEVMACDTR
ARMCARTCIAQRWRER
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgcgacgtgtggtagtgctgggcattactggttctattggagctgcagcactc
aaacttctgcgtcggtttcccgatcggttcttgctggtgggcgcttcaggtcaccggcag
accgagtacgcgcgggcgttggcgcgcgagttctctttatcagatatcactatgactggc
tcatgttctgagcaagaaggtcgcgcacgcataaagcgtctgctttcttcctgtgaagca
gaggtggtggtaaacggtattgccggcgctgctggtctttttgcctctcttgaggtgctc
aagacgcgttgtacgctcgcgttagcaaataaagaaagtgtggtacttgcagcttctctt
ttgcatgctgcggcacgcgaaagtggggcaacaatcgttcctgtagattcagagcatgct
gctatttttcaacttattgcagcgcacggcgcgcatgcggtggcgcaggtagtgctcact
gcgtcaggtggtccatttagaaccttttcaaaggagtgcttagcgcatgtcacggtggaa
gatgcgcttcaacatccgacgtggcgtatggggaagaagatttctgttgattctgcaaca
cttgcaaataaggcactggaagttatagaagcagtgcagttttttcgtataccggtggat
cgggtcacggtggtggtgcaccctcagagcatagtgcatgcgctggtgcaatgtcattcg
ggagaaacgtatgcgcagctttctgtccctgatatggcgtcgccgttactgtatgcgttg
ctgtaccctgatgcgcctcctgcgtatcaaactccgcttgattttacatcgggactgtct
ttgcattttgaacctccgagggtagatgactttccgctgttgcgtatgggttttgatgtt
gcacgggcgcagcgtgcgtatcctattgcctttaatgcagcaaatgaggaggcggtgcgt
gcgttcttgcaaagaaacattgggtttttagatatcgcacacgtgactgcacaggcgttg
caagaagattggcgcgcaattccccaaacgtttgaagaagttatggcgtgcgatacgcgt
gcgcggatgtgtgcgcggacgtgcattgcacagaggtggagagagaggtga

DBGET integrated database retrieval system