KEGG   Treponema pallidum subsp. pertenue SamoaD: TPESAMD_1004Help
Entry
TPESAMD_1004      CDS       T01751                                 

Gene name
recR
Definition
recombination protein R
Orthology
K06187  
recombination protein RecR
Organism
tpm  Treponema pallidum subsp. pertenue SamoaD
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tpm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TPESAMD_1004 (recR)
DNA repair and recombination proteins [BR:tpm03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      TPESAMD_1004 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1094248..1094853)
Genome map
AA seq 201 aa AA seqDB search
MIPAIEEVVEHLSRLPGIGVKLATRLAYHLLKRDPAEAQVLARGIACLHERVYRCVCCGA
FCEGRTCALCTDASRDRGIICVVERAQDVEMMAGVGEYRGLFHVLGGVIAPLEGVGPDQL
RIAALLKRLQESSVREVILALNPTVEGDTTALYVQKILANFPVIVTRLASGIPVGGDLEY
IDRTTLAHSLRGRRPLDCSEA
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgataccggcgattgaagaagtagtggagcatttatctcgtctcccgggtattggagta
aagctggcgacgcgccttgcctatcaccttttgaaacgtgaccccgctgaagcgcaggtt
cttgcgcgcgggattgcgtgtttgcatgagcgcgtatatcggtgtgtgtgctgcggtgct
ttctgtgaggggaggacctgcgcgttgtgcacggatgcgtctcgggaccgaggcatcatt
tgtgtagtggagcgtgcgcaggacgtggaaatgatggcgggtgtgggggagtatcggggt
ttattccacgtgttaggaggagtcattgcaccgcttgagggggtcggtcctgaccagctc
cgtattgcggcgttgctgaaacggttgcaagagagttcagtacgggaagttattctggcg
ttgaatcccaccgtggaaggggataccaccgccttgtatgtgcaaaaaatccttgcaaac
tttccggtaatagtaacgcgtctagcgtctggtatccccgtagggggggacttagaatat
atcgaccgaacgacattggcgcacagcctgcgtgggcgccggccacttgattgctcggag
gcttag

DBGET integrated database retrieval system