KEGG   Candidatus Tremblaya princeps PCIT: TPPCIT_062Help
Entry
TPPCIT_062        CDS       T01563                                 

Gene name
thrC
Definition
putative threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tpn  Candidatus Tremblaya princeps PCIT
Pathway
Glycine, serine and threonine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tpn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TPPCIT_062 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TPPCIT_062 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TPPCIT_062 (thrC)
Enzymes [BR:tpn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TPPCIT_062 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(59374..60738)
Genome map
AA seq 454 aa AA seqDB search
MYFSRALLAGMAWDGGLYMPASYPTPIGAPAWRFMAYSELAFRMLRRFARGTCRTLLRAV
CRTAYRRGFGCADAKGCARDAVGASWIAGRLYLGGLSWGPSLSFKDLAMQALGVAFACLV
WHHYHIVGATSGDTGGAACRAIAGSRKVGLLVLSPAGGVSAFQAEQMYGTMARNVVNACL
HGGFDCCQDVVKALLGMRRRDVGTANSINLSRLLLQSTYYLALRERLVTWPGERLCYHIP
SGNFGNTFACHMAMICGTHCFHATVATNENNVLDCFLKGGVCVSRTDTVVKRTHTPSMDI
SWASNVERLLYDVLGRSGSMAGRAARARGNSAAWVLLAHSSYRCLRSCAVSSDASLHLER
AMLVELMYRRHGVAVDTHTAAALKSAMLAPRGDVQVALETARDVKLKAELHGTYGNGYRH
AVPRRARHARHVSPACAHVRRLLGIPAAWVSAGA
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgtacttctcgcgggccctgcttgccggcatggcatgggatggaggcctgtacatgcct
gcttcttaccccacgccgattggagcgcccgcatggcgcttcatggcgtacagcgagctt
gccttcaggatgctcagacgtttcgcgcgcggtacgtgccgcacattgctcagggccgtg
tgcaggacagcttaccgtcgtgggttcggatgcgctgacgcaaaagggtgcgcaagggat
gcagtaggcgcctcgtggatagcggggcgcctatacctgggcggtctatcatgggggcca
tcactatcattcaaggacctagcaatgcaggcgctcggagtggcctttgcgtgcctagtt
tggcaccactaccacatcgtgggcgctacgtctggggacactggaggagccgcatgccgc
gccatcgcaggtagcaggaaggtagggctcctggtgctctcgcctgctggaggcgtgtct
gcgttccaggcagagcaaatgtatggcaccatggcccgaaacgttgtcaatgcctgcctg
cacggagggttcgactgctgccaggacgtagtgaaggccctcctcggcatgcggcgcagg
gacgtaggcacagcaaactccataaacctgtccagactcttgctgcagtctacgtactac
ctggcactgcgtgagaggttagttacctggccgggtgagcgcttgtgctatcacatccca
tcggggaacttcgggaataccttcgcctgccacatggccatgatctgtggcacgcattgc
ttccatgccaccgtagccacgaacgagaataatgtacttgactgcttccttaaagggggc
gtatgcgtatcgcgcaccgatacggtagtgaagcgcacgcacacaccgagcatggatata
tcttgggcctcaaacgttgagaggctgctgtacgatgtgctggggcgcagcggcagcatg
gcagggagggcagctcgcgcacgtggcaactccgcagcgtgggttctactggcgcattct
agctacaggtgcctgaggtcgtgcgcagtttcatcggacgcctcgttgcacttagagcgg
gccatgcttgtcgagctgatgtaccgacggcatggcgtggcagtagacactcacaccgcc
gcagcactaaagtcggccatgcttgcaccaaggggggacgtacaggtggctcttgagacc
gcgcgggacgtcaagctgaaggcagagctgcacggaacgtatggcaatggctacaggcac
gcagttcctcgtcgcgcaaggcatgcccggcacgtgagcccggcttgcgcacacgttcgc
aggctccttggcatacccgcagcgtgggtcagcgcaggcgcctag

  All links  
No link information was found.   
DBGET integrated database retrieval system