KEGG   Candidatus Tremblaya princeps PCIT: TPPCIT_062Help
Entry
TPPCIT_062        CDS       T01563                                 

Gene name
thrC
Definition
(RefSeq) putative threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tpn  Candidatus Tremblaya princeps PCIT
Pathway
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tpn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TPPCIT_062 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TPPCIT_062 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TPPCIT_062 (thrC)
Enzymes [BR:tpn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TPPCIT_062 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(59374..60738)
Genome map
AA seq 454 aa AA seqDB search
MYFSRALLAGMAWDGGLYMPASYPTPIGAPAWRFMAYSELAFRMLRRFARGTCRTLLRAV
CRTAYRRGFGCADAKGCARDAVGASWIAGRLYLGGLSWGPSLSFKDLAMQALGVAFACLV
WHHYHIVGATSGDTGGAACRAIAGSRKVGLLVLSPAGGVSAFQAEQMYGTMARNVVNACL
HGGFDCCQDVVKALLGMRRRDVGTANSINLSRLLLQSTYYLALRERLVTWPGERLCYHIP
SGNFGNTFACHMAMICGTHCFHATVATNENNVLDCFLKGGVCVSRTDTVVKRTHTPSMDI
SWASNVERLLYDVLGRSGSMAGRAARARGNSAAWVLLAHSSYRCLRSCAVSSDASLHLER
AMLVELMYRRHGVAVDTHTAAALKSAMLAPRGDVQVALETARDVKLKAELHGTYGNGYRH
AVPRRARHARHVSPACAHVRRLLGIPAAWVSAGA
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgtacttctcgcgggccctgcttgccggcatggcatgggatggaggcctgtacatgcct
gcttcttaccccacgccgattggagcgcccgcatggcgcttcatggcgtacagcgagctt
gccttcaggatgctcagacgtttcgcgcgcggtacgtgccgcacattgctcagggccgtg
tgcaggacagcttaccgtcgtgggttcggatgcgctgacgcaaaagggtgcgcaagggat
gcagtaggcgcctcgtggatagcggggcgcctatacctgggcggtctatcatgggggcca
tcactatcattcaaggacctagcaatgcaggcgctcggagtggcctttgcgtgcctagtt
tggcaccactaccacatcgtgggcgctacgtctggggacactggaggagccgcatgccgc
gccatcgcaggtagcaggaaggtagggctcctggtgctctcgcctgctggaggcgtgtct
gcgttccaggcagagcaaatgtatggcaccatggcccgaaacgttgtcaatgcctgcctg
cacggagggttcgactgctgccaggacgtagtgaaggccctcctcggcatgcggcgcagg
gacgtaggcacagcaaactccataaacctgtccagactcttgctgcagtctacgtactac
ctggcactgcgtgagaggttagttacctggccgggtgagcgcttgtgctatcacatccca
tcggggaacttcgggaataccttcgcctgccacatggccatgatctgtggcacgcattgc
ttccatgccaccgtagccacgaacgagaataatgtacttgactgcttccttaaagggggc
gtatgcgtatcgcgcaccgatacggtagtgaagcgcacgcacacaccgagcatggatata
tcttgggcctcaaacgttgagaggctgctgtacgatgtgctggggcgcagcggcagcatg
gcagggagggcagctcgcgcacgtggcaactccgcagcgtgggttctactggcgcattct
agctacaggtgcctgaggtcgtgcgcagtttcatcggacgcctcgttgcacttagagcgg
gccatgcttgtcgagctgatgtaccgacggcatggcgtggcagtagacactcacaccgcc
gcagcactaaagtcggccatgcttgcaccaaggggggacgtacaggtggctcttgagacc
gcgcgggacgtcaagctgaaggcagagctgcacggaacgtatggcaatggctacaggcac
gcagttcctcgtcgcgcaaggcatgcccggcacgtgagcccggcttgcgcacacgttcgc
aggctccttggcatacccgcagcgtgggtcagcgcaggcgcctag

DBGET integrated database retrieval system