KEGG   Treponema pallidum subsp. pallidum Mexico A: TPAMA_1004Help
Entry
TPAMA_1004        CDS       T02273                                 

Gene name
recR
Definition
recombination protein R
Orthology
K06187  
recombination protein RecR
Organism
tpo  Treponema pallidum subsp. pallidum Mexico A
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tpo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TPAMA_1004 (recR)
DNA repair and recombination proteins [BR:tpo03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      TPAMA_1004 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1094578..1095183)
Genome map
AA seq 201 aa AA seqDB search
MIPAIEEVVEHLSRLPGIGVKLATRLAYHLLKRDPAEAQVLARGIACLHERVYRCVCCGA
FCEGRTCALCTDASRDRGIICVVERAQDVEMMAGVGEYRGLFHVLGGVIAPLEGVGPDQL
RIAALLKRLQESSVREVILALNPTVEGDTTALYVQKILANFPVIVTRLASGIPVGGDLEY
IDRTTLAHSLRGRRPLDCSEA
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgataccggcgattgaagaagtagtggagcatttatctcgtctcccgggtattggagta
aagctggcgacgcgccttgcctatcaccttttgaaacgtgaccccgctgaagcgcaggtt
cttgcgcgcgggattgcgtgtttgcatgagcgcgtatatcggtgtgtgtgctgcggtgct
ttctgtgaggggaggacctgcgcgttgtgcacggatgcgtctcgggaccgaggcatcatt
tgtgtagtggagcgtgcgcaggacgtggaaatgatggcgggtgtgggggagtatcggggt
ttattccacgtgttaggaggagtcattgcaccgcttgagggggtcggtcctgaccagctc
cgtattgcggcgttgctgaaacggttgcaagagagttcagtacgggaagttattctggcg
ttgaatcccaccgtggaaggggataccaccgccttgtatgtgcaaaaaatccttgcaaac
tttccggtaatagtaacgcgtctagcgtctggtatccccgtagggggggacttagaatat
atcgaccgaacgacattggcgcacagcctgcgtgggcgccggccacttgattgctcggag
gcttag

DBGET integrated database retrieval system