KEGG   Treponema pallidum subsp. pallidum SS14: TPASS_0029Help
Entry
TPASS_0029        CDS       T00716                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
tpp  Treponema pallidum subsp. pallidum SS14
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tpp00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TPASS_0029 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    TPASS_0029 (murA)
Enzymes [BR:tpp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     TPASS_0029 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
36908..38185
Genome map
AA seq 425 aa AA seqDB search
MSCYRVEGGFPVSGCIRVCGNKNAALPCIAAAVLTQEPVLLQNVPDIEDVAVMLTIFRAF
GGSVERRGNHEYMLHLPQLQTCEVPCEAAQKVRASILFAGPLLARGRKAVLPPPGGDVIG
RRRLDTHFLALAALGAQVRLDGVFTFSANKLVGCDVFLDEASVTATENVLMASVLAEGVT
VITNAASEPHVQDLCHLLNAMGARVSGIGSNVLTIEGVSALHGTTYTLGADFMEVGSLIG
LAVVTRGALTISDVNVRDLRPLGFAFKKLGVIWSEQEHAVSVSASQDLRVNYDFGGMIPK
IDDGPWPAFPPDLTSIMTVVATQVEGVILIHEKMFESRMFFVDKLITMGARIILCDPHRA
LVSGPSALHGSDLVSPDVRAGMAMVLAACCARGVSIIRNVYQIERGYERLVERLQAIGVR
IWKEG
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgagttgctatcgtgttgaaggtgggtttcccgtttcaggttgtattcgcgtgtgtgga
aataagaatgcagcgcttccctgtattgcggcggcagttctcacacaagagccagtgtta
ctgcaaaatgtgcccgacattgaggatgtggcggtgatgttaactatctttcgtgcgttt
ggtgggagtgttgaaaggcgtggtaatcatgagtacatgttacatcttcctcagttacag
acgtgcgaagtgccgtgcgaggctgcgcagaaagtgcgtgcttccattctttttgcaggg
ccacttcttgcgcgtggtagaaaagcagtgcttccaccacctggtggtgatgttattggg
cgcaggagacttgatacgcattttcttgcgcttgccgcacttggcgcacaagttcgttta
gatggggtgtttactttctctgcaaataagctggtgggatgtgatgtcttcttagacgag
gcatctgtgacggcgacagagaatgtgcttatggcttcagttcttgccgagggggttacg
gtaatcacgaacgcggcgagcgaaccgcatgtgcaagatctatgccatttgttgaatgcg
atgggtgcgcgcgtctctggcatcggatcgaatgttttaacaattgagggggtgagcgcg
ttgcatggtaccacatatacacttggggctgatttcatggaagtaggttcgcttattggg
cttgcggtagtaacgcgtggagcattgacgatttcggatgtgaacgtacgtgatctacgt
ccactaggttttgcgtttaaaaaacttggagtaatttggagcgagcaagagcacgcggta
agcgtctctgcgtcgcaggatctgcgggtaaattacgattttggcggtatgattcctaaa
atagatgatggcccgtggcctgcatttccgccggatctgactagcattatgacagtggtg
gcgactcaagtcgaaggggttatattgattcatgagaaaatgtttgagtcgcgtatgttt
tttgtggacaagttaattaccatgggtgcgcgtatcatcctgtgtgacccgcatcgggcg
cttgtttcaggtccgagtgcattgcatgggagtgacctggtatctcctgatgtgcgtgcg
ggaatggcgatggtgcttgcagcgtgttgtgcgcgcggggtaagtataatccgtaacgtg
tatcaaattgagcgtggatatgaacgtctagtggagcgtttgcaggcaattggtgtccgt
atttggaaagagggttga

DBGET integrated database retrieval system