KEGG   Treponema pallidum subsp. pallidum SS14: TPASS_0068Help
Entry
TPASS_0068        CDS       T00716                                 

Definition
hypothetical protein
Orthology
K06941  
23S rRNA (adenine2503-C2)-methyltransferase [EC:2.1.1.192]
Organism
tpp  Treponema pallidum subsp. pallidum SS14
Brite
Enzymes [BR:tpp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.192  23S rRNA (adenine2503-C2)-methyltransferase
     TPASS_0068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
74008..75030
Genome map
AA seq 340 aa AA seqDB search
MEWCCALSGLLPEEIQKVCAFAERFRGVQVFRWIAAGCTDFHAMSDLSSETRARLARACV
ISDTRVYTTLRDVDGTLKLGIELKDKRRVEAVLLVDQVSRKTACLSCQVGCPMACAFCQT
GQLGFARNLSASEIVEQFLHLERCVGTLDNVVFMGMGEPMLNLDAVCRAIEILSHPQGRD
LSEKRITISTSGHCRGIYSLADRALQVRLAVSLTTANAPLRARLMPRAAHDSLAKLKSAI
RYFNEKSGKRVTLELALMRGVNTSERHAQEVIDFAHGLNVHVNLIPWNPVASIHFETPRE
VEVAHFEALLMRARIPVTRRYQRGNGIGGACGQLGKTAGV
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggagtggtgctgcgccctttcggggcttttgccagaagaaatccagaaggtgtgtgcg
tttgctgagcgctttcgtggggtgcaggtgttcagatggattgccgcagggtgcactgac
ttccatgcgatgagtgatctctcttctgagacgcgtgcacgcctggcgagggcgtgcgtc
atctcggacactcgtgtctataccacgctgcgtgatgtggatggtacgctcaagctgggt
attgaactgaaagataaacggcgcgtagaggcagtcttactcgtcgatcaagtctcgcgt
aagactgcttgtctatcctgtcaagtcggctgccctatggcgtgcgcgttttgtcaaaca
ggccagttgggtttcgcgcgaaacctttctgcctcagagatcgtcgagcagttccttcat
ctggaacgatgtgtcggtacattggataatgttgtgtttatgggaatgggtgagcccatg
ctcaatctggatgcggtgtgtagagctattgagatactgtctcatccacagggtcgtgac
ctatctgaaaaacgtattactatttctacgtctggacattgccgtggtatttattcgctt
gctgaccgcgcactgcaggttcgcttggcggtgtctttaaccaccgcgaatgcaccgttg
cgcgcacgcctcatgccacgtgctgcgcacgacagtttagcaaaactgaaaagcgctatt
cgctattttaacgagaagagtggaaagcgtgtgacactcgagctcgccctcatgcgggga
gtgaatacttctgaacggcatgcgcaagaagttatcgattttgcacatgggcttaacgtg
cacgtgaacttaattccctggaatccggtagcatcaatccactttgaaacacctcgggaa
gtggaggttgcgcattttgaggcgcttctcatgcgcgcccgcatccccgtgacacgccgc
tatcagcgtgggaatggcattggaggcgcatgcggacaactaggtaaaacagccggcgtg
taa

DBGET integrated database retrieval system