KEGG   Treponema pallidum subsp. pallidum SS14: TPASS_0168Help
Entry
TPASS_0168        CDS       T00716                                 

Gene name
gpmA
Definition
phosphoglyceromutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
tpp  Treponema pallidum subsp. pallidum SS14
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tpp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TPASS_0168 (gpmA)
   01230 Biosynthesis of amino acids
    TPASS_0168 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TPASS_0168 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    TPASS_0168 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TPASS_0168 (gpmA)
Enzymes [BR:tpp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     TPASS_0168 (gpmA)
Exosome [BR:tpp04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   TPASS_0168 (gpmA)
  Exosomal proteins of melanoma cells
   TPASS_0168 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
190194..190949
Genome map
AA seq 251 aa AA seqDB search
MKLVLIRHGESEWNRLNLFTGWTDVPLTPRGESEAQEGGRVLQEAGFDFDLCYTSFLKRA
IRTLNFVLQALDREWLPVHKSWKLNERHYGDLQGLNKTETAQKYGEQQVRVWRRSFDVAP
PPLTVGDARCPHTQASYRGVCASGRTPVLPFTESLKDTVARVVPYFEEEIKPQMISGQRV
LIVAHGNSLRALMKHIESLDETQIMEVNLPTGVPLVYEFEADFTLCGKRFLGNEADVAAR
AQAVADQGKSN
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttgtgttgatccgtcatggagaaagtgaatggaacaggctgaacctgttcact
ggttggacagatgttccgcttaccccacgtggggagtcggaagcccaggaaggaggccgc
gtactgcaagaagcggggtttgattttgacctatgctacacttctttcttgaaacgtgcc
attcgtacgctcaattttgtactccaggcactggaccgtgagtggttgccggttcacaaa
agctggaaattgaacgagcggcattatggggatctacaaggtttaaataagacagagacg
gcgcagaagtatggtgagcagcaggttagggtgtggcgtcgctcctttgatgtggctcct
cctccgcttactgtaggggacgcacgttgtccgcatactcaagcctcctaccggggggta
tgcgcgtctggtcggacgccagtacttccgtttacggaaagtttgaaagataccgttgcg
cgtgtggtgccgtattttgaagaggaaatcaaaccgcagatgatttccggacagcgtgtg
cttattgtggcgcatggtaactcgttgcgcgcactgatgaagcacatagagtctttggat
gagactcagataatggaagtaaatttgcctaccggtgtaccgcttgtctatgagttcgag
gcggattttaccctgtgtgggaagcgttttttaggtaatgaggcggatgttgcagcgagg
gcgcaggctgtggctgatcagggtaagagtaactaa

DBGET integrated database retrieval system