KEGG   Treponema pallidum subsp. pallidum SS14: TPASS_0371Help
Entry
TPASS_0371        CDS       T00716                                 

Definition
hypothetical protein
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
tpp  Treponema pallidum subsp. pallidum SS14
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tpp00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TPASS_0371
Enzymes [BR:tpp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     TPASS_0371
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
395959..396834
Genome map
AA seq 291 aa AA seqDB search
MQSLSLRAHAKVNMHLWVGARRADGLHSIESVMQRITLADSLSLSRLDIPGRCEVCSPYM
ALPRENTLTRAYARFCQVTGVHDGVRVRVVKRIPAGSGLGGGSADAAALLCGLDTLFGTT
LSARVLREVAYSVGSDVPFFLASQAACVLGGGEQLVPLVPKTGYLGLLVWPGLHSGSAQA
YEDLDRLRACGVHAADGEQYSLRGATALSAHYAQDCARWRFFNSLDAPVQRRYPVVALAR
WDLARAGACFTAMSGSGSXVFGLYRDEEELRRAHKLLAKRWCWCVRVRLCG
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
gtgcagtcgctgagtttgcgcgctcacgcaaaggtgaacatgcatctgtgggttggtgca
cgtcgggccgatggtcttcactcgattgagagtgtaatgcagcgcattacgcttgcggat
tctttgtctctttcgcgcctggatatccctggccggtgtgaggtgtgttcgccttatatg
gctctgcctcgagaaaacacgctgacccgtgcgtatgcgcggttttgtcaggtaactggc
gttcacgatggtgtgcgcgtgcgcgtagtgaagcgtatccctgcagggtctggacttggt
ggggggtctgctgatgctgccgcgcttttgtgtggccttgatacgttgtttgggacgacc
ctttctgctcgggttctacgagaagtggcgtatagtgtcggcagtgatgtcccttttttc
ctggcttcccaggctgcgtgcgtgctaggtggtggtgagcagctcgttccccttgttcca
aagactggctatctggggcttttggtctggccgggattgcacagcggttctgcacaggcc
tatgaggatttggacaggttgcgtgcgtgcggcgtacatgctgccgacggcgagcagtac
tctctgcgtggggctaccgcgctttctgcgcactatgcacaggattgtgcgcggtggcgg
ttttttaatagcttagatgcccctgtacagcgtcggtaccctgtagtcgcccttgcgcgt
tgggatctggcccgtgcgggtgcgtgctttacagcgatgagtggaagcgggagcscggtt
tttggtctgtatcgggatgaggaggagcttcggcgcgcgcataagctgcttgcaaagcgg
tggtgttggtgtgtgcgtgtccggttatgtgggtag

DBGET integrated database retrieval system