KEGG   Treponema pallidum subsp. pallidum SS14: TPASS_0601Help
Entry
TPASS_0601        CDS       T00716                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
tpp  Treponema pallidum subsp. pallidum SS14
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tpp00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TPASS_0601 (dxr)
Enzymes [BR:tpp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     TPASS_0601 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(654374..655525)
Genome map
AA seq 383 aa AA seqDB search
MFWDRCSMSVRRVVVLGITGSIGAAALKLLRRFPDRFLLVGASGHRQTEYARALAREFSL
SDITMTGSCSEQEGRARIKRLLSSCEAEVVVNGIAGAAGLFASLEVLKTRCTLALANKES
VVLAASLLHAAARESGATIVPVDSEHAAIFQLIAAHGAHAVAQVVLTASGGPFRTFSKEC
LAHVTVEDALQHPTWRMGKKISVDSATLANKALEVIEAVQFFRIPVDRVTVVVHPQSIVH
ALVQCHSGETYAQLSVPDMASPLLYALLYPDAPPAYQTPLDFTSGLSLHFEPPRVDDFPL
LRMGFDVARAQRAYPIAFNAANEEAVRAFLQRNIGFLDIAHVTAQALQEDWRAIPQTFEE
VMACDTRARMCARTCIAQRWRER
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
gtgttttgggatcgctgcagtatgagtgtgcgacgtgtggtagtgctgggcattactggt
tctattggagctgcagcactcaaacttctgcgtcggtttcccgatcggttcttgctggtg
ggcgcttcaggtcaccggcagaccgagtacgcgcgggcgttggcgcgcgagttctcttta
tcagatatcactatgactggctcatgttctgagcaagaaggtcgcgcacgcataaagcgt
ctgctttcttcctgtgaagcagaggtggtggtaaacggtattgccggcgctgctggtctt
tttgcctctcttgaggtgctcaagacgcgttgtacgctcgcgttagcaaataaagaaagt
gtggtacttgcagcttctcttttgcatgctgcggcacgcgaaagtggggcaacaatcgtt
cctgtagattcagagcatgctgctatttttcaacttattgcagcgcacggcgcgcatgcg
gtggcgcaggtagtgctcactgcgtcaggtggtccatttagaaccttttcaaaggagtgc
ttagcgcatgtcacggtggaagatgcgcttcaacatccgacgtggcgtatggggaagaag
atttctgttgattctgcaacacttgcaaataaggcactggaagttatagaagcagtgcag
ttttttcgtataccggtggatcgggtcacggtggtggtgcaccctcagagcatagtgcat
gcgctggtgcaatgtcattcgggagaaacgtatgcgcagctttctgtccctgatatggcg
tcgccgttactgtatgcgttgctgtaccctgatgcgcctcctgcgtatcaaactccgctt
gattttacatcgggactgtctttgcattttgaacctccgagggtagatgactttccgctg
ttgcgtatgggttttgatgttgcacgggcgcagcgtgcgtatcctattgcctttaatgca
gcaaatgaggaggcggtgcgtgcgttcttgcaaagaaacattgggtttttagatatcgca
cacgtgactgcacaggcgttgcaagaagattggcgcgcaattccccaaacgtttgaagaa
gttatggcgtgcgatacgcgtgcgcggatgtgtgcgcggacgtgcattgcacagaggtgg
agagagaggtga

DBGET integrated database retrieval system