KEGG   Candidatus Tremblaya princeps PCVAL: TCP_040Help
Entry
TCP_040           CDS       T01858                                 

Gene name
rmpE
Definition
50S ribosomal protein L31
Orthology
K02909  
large subunit ribosomal protein L31
Organism
tpq  Candidatus Tremblaya princeps PCVAL
Pathway
Ribosome
Brite
KEGG Orthology (KO) [BR:tpq00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    TCP_040 (rmpE)
Ribosome [BR:tpq03011]
 Ribosomal Proteins
  Bacteria
   Large subunit
    TCP_040 (rmpE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
38677..38880
Genome map
AA seq 67 aa AA seqDB search
MQDARYRPATFHDAAGCLTLLTRSTLAPKGSNNLGCAAYPMLKIDLTSSTHSAYARRGPV
VHTRRLR
NT seq 204 nt NT seq  +upstreamnt  +downstreamnt
atgcaggacgcgaggtacaggccagcgacgttccacgacgcagctggctgcctgacgctt
ctgaccagatccacactggcgccaaaggggtcgaacaaccttggttgtgccgcgtacccc
atgttgaagatagatctaacatcgtccacgcacagcgcctatgctaggcgaggaccagtt
gttcacactaggcgcctgcgctga

DBGET integrated database retrieval system