KEGG   Candidatus Tremblaya princeps PCVAL: TCP_040Help
Entry
TCP_040           CDS       T01858                                 

Gene name
rmpE
Definition
50S ribosomal protein L31
Orthology
K02909  
large subunit ribosomal protein L31
Organism
tpq  Candidatus Tremblaya princeps PCVAL
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:tpq00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    TCP_040 (rmpE)
Ribosome [BR:tpq03011]
 Ribosomal Proteins
  Bacteria
   Large subunit
    TCP_040 (rmpE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
38677..38880
Genome map
AA seq 67 aa AA seqDB search
MQDARYRPATFHDAAGCLTLLTRSTLAPKGSNNLGCAAYPMLKIDLTSSTHSAYARRGPV
VHTRRLR
NT seq 204 nt NT seq  +upstreamnt  +downstreamnt
atgcaggacgcgaggtacaggccagcgacgttccacgacgcagctggctgcctgacgctt
ctgaccagatccacactggcgccaaaggggtcgaacaaccttggttgtgccgcgtacccc
atgttgaagatagatctaacatcgtccacgcacagcgcctatgctaggcgaggaccagtt
gttcacactaggcgcctgcgctga

DBGET integrated database retrieval system