KEGG   Candidatus Tremblaya princeps PCVAL: TCP_041Help
Entry
TCP_041           CDS       T01858                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tpq  Candidatus Tremblaya princeps PCVAL
Pathway
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tpq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TCP_041 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TCP_041 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TCP_041 (thrC)
Enzymes [BR:tpq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TCP_041 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(38864..40267)
Genome map
AA seq 467 aa AA seqDB search
MFTSTRTGPAQPGMYFSRALLAGMAWDGGLYMPASYPTPIGAPAWRFMAYSELAFRMLRR
FARGTCRTLLRAVCRTAYRRGFGCADAKGCARDAVGASWIAGRLYLGGLSWGPSLSFKDL
AMQALGVAFACLVWHHYHIVGATSGDTGGAACRAIAGSRKVGLLVLSPAGGVSAFQAEQM
YGTMARNVVNACLHGGFDCCQDVVKALLGMRRRDVGTANSINLSRLLLQSTYYLALRERL
VTWPGERLCYHIPSGNFGNTFACHMAMICGTHCFHATVATNENNVLDCFLKGGVCVSRTD
TVVKRTHTPSMDISWASNVERLLYDVLGRSGSMAGRAARARGNSAAWVLLAHSSYRCLRS
CAVSSDASLHLERAMLVELMYRRHGVAVDTHTAAALKSAMLAPRGDVQVALETARDVKLK
AELHGTYGNGYRHAVPRRARHARHVSPACAHVRRLLGIPAAWVSAGA
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
gtgttcacttccacacgcacagggccagcgcagcctggcatgtacttctcgcgggccctg
cttgccggcatggcatgggatggaggcctgtacatgcctgcttcttaccccacgccgatt
ggagcgcccgcatggcgcttcatggcgtacagcgagcttgccttcaggatgctcagacgt
ttcgcgcgcggtacgtgccgcacattgctcagggccgtgtgcaggacagcttaccgtcgt
gggttcggatgcgctgacgcaaaagggtgcgcaagggatgcagtaggcgcctcgtggata
gcggggcgcctatacctgggcggtctatcatgggggccatcactatcattcaaggaccta
gcaatgcaggcgctcggagtggcctttgcgtgcctagtttggcaccactaccacatcgtg
ggcgctacgtctggggacactggaggagccgcatgccgcgccatcgcaggtagcaggaag
gtagggctcctggtgctctcgcctgctggaggcgtgtctgcgttccaggcagagcaaatg
tatggcaccatggcccgaaacgttgtcaatgcctgcctgcacggagggttcgactgctgc
caggacgtagtgaaggccctcctcggcatgcggcgcagggacgtaggcacagcaaactcc
ataaacctgtccagactcttgctgcagtctacgtactacctggcactgcgtgagaggtta
gttacctggccgggtgagcgcttgtgctatcacatcccatcggggaacttcgggaatacc
ttcgcctgccacatggccatgatctgtggcacgcattgcttccatgccaccgtagccacg
aacgagaataatgtacttgactgcttccttaaagggggcgtatgcgtatcgcgcaccgat
acggtagtgaagcgcacgcacacaccgagcatggatatatcttgggcctcaaacgttgag
aggctgctgtacgatgtgctggggcgcagcggcagcatggcagggagggcagctcgcgca
cgtggcaactccgcagcgtgggttctactggcgcattctagctacaggtgcctgaggtcg
tgcgcagtttcatcggacgcctcgttgcacttagagcgggccatgcttgtcgagctgatg
taccgacggcatggcgtggcagtagacactcacaccgccgcagcactaaagtcggccatg
cttgcaccaaggggggacgtacaggtggctcttgagaccgcgcgggacgtcaagctgaag
gcagagctgcacggaacgtatggcaatggctacaggcacgcagttcctcgtcgcgcaagg
catgcccggcacgtgagcccggcttgcgcacacgttcgcaggctccttggcatacccgca
gcgtgggtcagcgcaggcgcctag

DBGET integrated database retrieval system