KEGG   Tsukamurella paurometabola: Tpau_0423Help
Entry
Tpau_0423         CDS       T01228                                 

Definition
glycoside hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
tpr  Tsukamurella paurometabola
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tpr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Tpau_0423
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Tpau_0423
Enzymes [BR:tpr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Tpau_0423
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
446268..447431
Genome map
AA seq 387 aa AA seqDB search
MMRLFRNLTVMVIAAAGVAACGTSSGPDAPTSVTSAVPAPNSSTASSSAAARPVSCEIDY
LSKLSVREKVAQLLMVGVKDAADARRAVQQYGVGGIFVGSWTDKSIFAGGALKQVSAAGK
VPLMVSVDEEGGRVSRVPGANLVSARQLAKTKTVEQARAEGKRVGALMASMGITVDFAPD
ADVSAQLADSVIGDRSYSDDPAVVTKYAKAFAAGLRDGGVYPVYKHFPGHGHSSGDSHQG
GVSVPPLAELKKKDLVPFRAAATDDAGIMVGHLTVPGLTEKGTPTSLSPNTMRLLRDGAG
YGAAPFAGPIFTDDLSGMKAVTDTFTVPQAVTKALVAGADVALWISTDQLGAAVAQVEAA
VRAGTLPMQRLDASVLRVARAKHAVRC
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgattgtttcgaaacctcacggtcatggtgatcgccgcggcgggtgtcgccgcg
tgcggcacatcctccggaccggacgcccccacgtcggtaacgtccgcggtacccgcaccg
aacagctccacggcatcgtcctcggccgcagctcgcccagtgagctgcgagatcgactac
ctgagcaagctcagcgtgcgggagaaggtggcccagctgctcatggtgggggtcaaggat
gccgccgacgctcgccgtgcggtacagcagtacggcgtcggcggcattttcgtgggcagc
tggacggacaagtcgatcttcgccggtggtgcgctcaaacaagtctcggccgcgggcaag
gtgccgctcatggtgtcggtcgacgaggagggcggccgagtatcccgggtgcccggcgcg
aacctggtctccgcacgccaactcgcgaagaccaagacggtcgagcaggcgcgggccgaa
ggcaagcgagtgggcgccctgatggcgtcgatggggatcaccgtcgacttcgcgcccgat
gcggatgtctctgcgcagctagctgattcggtgatcggcgaccgctcctactccgacgac
cccgccgtggtgaccaaatacgccaaggccttcgcggccgggctgcgtgatggcggcgtc
tacccggtgtacaagcacttcccgggccacggacactcctccggggattcgcatcagggc
ggggtgagtgtgccgccgctggcggagctgaagaagaaggacctggtgcccttccgcgcc
gccgcgaccgacgacgccggaatcatggtggggcacctcacggtgcccggtctcaccgag
aagggcacacccaccagcctcagcccgaacacgatgcggttgctgcgcgacggtgccgga
tacggtgccgccccgttcgccggcccgatcttcaccgacgatctgtccgggatgaaggcc
gtcaccgacaccttcacggtgccgcaggccgtgacgaaggccctggtggcaggtgctgac
gtggccctctggatctccaccgaccaactcggtgcggccgtcgcgcaggtcgaggcggcg
gtgcgggcgggcacgctgccgatgcagcggctcgacgcctcagtgctgcgggtggcgcgc
gcgaagcatgcggtgcgctgctga

DBGET integrated database retrieval system