KEGG   Tsukamurella paurometabola: Tpau_0560Help
Entry
Tpau_0560         CDS       T01228                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
tpr  Tsukamurella paurometabola
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tpr00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
590277..590873
Genome map
AA seq 198 aa AA seqDB search
MAAGDGAAIAPFDHERAVAAVRELLIAVGEDPEREGLKKTPERVARAFQEVFGGLHTDPD
SVLDTTFGEDHDELVLVKDIPMYSTCEHHLVSFHGVAHVGYLPGPSGRVTGLSKLARVVD
LYAKRPQVQERLTAQIADAVVRKLDPRGVIVVIEAEHLCMAMRGIRKPGASTTTSAVRGA
FKDSATSRAEALELILRR
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtggcggcgggcgacggggcggcgatcgcgcccttcgaccacgagcgtgccgtggccgcc
gtgcgggagctgctcatcgcggtcggcgaggatcccgaacgggagggactgaagaagact
cccgaacgcgtggcccgcgccttccaggaggtcttcggcggcctgcataccgaccctgat
tcggtgctggacaccaccttcggggaggatcacgacgagctggtgctggtcaaggacatc
ccgatgtactcgacctgcgagcatcatctggtgtccttccacggcgtcgcccacgtgggc
taccttcccggccccagcgggcgcgtcaccggcctgagcaaactggcccgcgtcgtcgat
ctgtacgccaagcggccgcaggtgcaggagcggctcaccgcccagatcgccgatgctgtt
gtgcgcaaactcgatccgcggggcgtgatcgtggtgatcgaggccgagcacctgtgcatg
gccatgcgcggcatccgcaagcccggggccagcaccaccacatcggccgtgcgcggggcg
ttcaaggacagcgccacctcgcgggctgaggcgctcgaactcatcctgcgccggtga

DBGET integrated database retrieval system