KEGG   Tsukamurella paurometabola: Tpau_0561Help
Entry
Tpau_0561         CDS       T01228                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
tpr  Tsukamurella paurometabola
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tpr00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
590870..591742
Genome map
AA seq 290 aa AA seqDB search
MNAASRAAAPPARPGGATLIMGVVNVTTDSFSDGGRYLDLDAALAHARELVAEGAAVVDV
GGESTRPGAHRVPAEVERDRVVPVITALAAEGIAVSVDTMRASVAAAALDAGAAIVNDVS
GGRADPAMAGVVAGSSAPWILMHWRPSPGAPGADTWSGIHHGVTDYTDVVTEVRDELLHQ
ADAAIAAGIAPERIVLDPGLGFAKNGDHNWALLRGLNTLQDTGFRVLVGASRKRFLGELL
GGRAPAGREVATAAISALAAREGVWGVRVHDVRATADAIAVARAWKKGGI
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgccgccagccgtgccgcggcaccgccggcccggcccggcggggccaccctcatc
atgggcgtggtcaacgtgaccaccgattcgttctccgacggcggccgctacctcgacctg
gacgccgcgctcgcgcacgcccgtgagctggtcgccgagggtgcagcggtggtcgacgtg
gggggcgaatcgacccgccccggcgcacatcgtgtgcccgcagaggtcgagcgcgaccgg
gtggttcccgtcatcaccgcgctcgccgccgaggggatcgccgtctccgtggacaccatg
cgggcctccgtggccgccgccgccctggacgcgggcgccgccatcgtcaacgacgtctcc
ggtggccgtgccgatcccgcgatggcgggtgtggtcgccggctcgagcgccccgtggatc
ctcatgcactggaggccgtcgcccggggcgccgggggccgacacctggagcggaatccac
cacggcgtcaccgactacaccgatgtggtcaccgaagtgcgcgatgagctgctgcaccag
gccgatgccgcgatcgctgccggtatcgcccccgagcggatcgtgctcgaccccgggctc
ggcttcgccaagaacggcgatcacaactgggcactgctgcggggattgaacaccttgcaa
gacaccgggttccgagtgctcgtgggtgcctcgcgcaagcgtttcctgggcgagctgctc
ggcggtcgtgctccggccggtcgcgaggtggcgaccgccgcgatctccgccctcgccgcc
cgggagggagtctggggtgtacgggtacacgacgtccgggccaccgccgacgccattgcg
gtcgcgcgggcctggaagaagggcggaatctga

DBGET integrated database retrieval system