KEGG   Tsukamurella paurometabola: Tpau_0670Help
Entry
Tpau_0670         CDS       T01228                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
tpr  Tsukamurella paurometabola
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:tpr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Tpau_0670
Enzymes [BR:tpr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Tpau_0670
Exosome [BR:tpr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Tpau_0670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
686792..687784
Genome map
AA seq 330 aa AA seqDB search
MSFPQVRPRRLRTTPAVRRLVAEVSVEPRQLVLPMFVRDGIDAPVPISSMPGVQQHTLDS
LRAAADEAVRAGVGGLMLFGVPDDADKDAEGSASWNPDGVLNRGLRALRDDLGDATVIMA
DTCLDEFTSHGHCGVLDAEGRVDNDATLERYALMGVAQAQAGAHMLGPSGMMDGQIGVLR
SALDTAGQHDVSLFAYTAKYASAFYGPFREAVGSSLQGDRRTYQQDAANRRESLRELDLD
VAEGADLVMVKPAMSYLDVLADVAAASPVPVAAYQISGEYAMITAAAQNGWIDRDSAIRE
SLLSIRRAGADVVLTYWAVEAAQRIARGQW
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgagttttccgcaggtgcgaccgcgacggctgcgcaccacgcccgccgtccgcaggttg
gtcgccgaggtctcggtcgagcccaggcagttggtgctgccgatgttcgtgcgggacggg
atcgacgccccggtgccgatctcatcgatgccgggggtgcagcagcacacgctcgattcg
ctgcgggccgccgccgacgaagccgtgcgcgccggagtcggtgggctgatgctgttcggc
gtgcccgacgatgccgataaggatgccgagggcagcgcgtcctggaatcccgacggtgtg
ctcaaccgcggcctgcgtgcgctccgcgatgacctgggcgacgcgacggtgatcatggcc
gacacctgcctggacgagttcacctcgcacgggcattgcggtgtgctcgatgcggagggg
cgcgtggataacgacgccactctggagcggtacgcgctgatgggcgtcgcgcaggcgcag
gccggagcacacatgctgggaccgtcggggatgatggacgggcagatcggcgtactccgg
tcggcgctggacaccgcgggacagcacgatgtttcactgttcgcctacaccgcgaagtac
gcctccgcgttctacggcccgttccgagaggcggtcgggtcctcgttgcagggcgatcgg
cgcacctaccagcaggacgcggcgaatcgtcgggaatcgttgcgcgagctggatctcgat
gtggccgagggcgccgatctggtgatggtgaagccggccatgagctatctggacgtgctg
gcggacgtggccgcggcgtcaccggttcccgttgccgcgtaccagatctccggtgagtac
gcgatgatcaccgcggccgcgcagaacggttggatcgaccgcgactccgcgatccgcgag
tccctgctgtcgatccgccgcgccggcgccgacgtggtgctcacgtactgggccgtcgag
gccgcgcagcgcatcgcacggggccagtggtga

DBGET integrated database retrieval system