KEGG   Tsukamurella paurometabola: Tpau_0716Help
Entry
Tpau_0716         CDS       T01228                                 

Definition
hypothetical protein
Organism
tpr  Tsukamurella paurometabola
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
732283..734751
Genome map
AA seq 822 aa AA seqDB search
MAAHARGKPVHAANSDGGDGVAQERLQGAFLTVIGVAGMFGGVMFSIEAPRFTPVPVVFL
TFWLIMVIVGRIFFTGLGKLRSAGVGAPAPEQVRAAAAVAGIVVAVGMMGFAATGPGTGV
ASAAPCPGGGPATCGPGPGPELTITPPAQQTTAPGGQQGNQGSGQDNNGIATSPAGSGGN
NGDGIQAQTPDFGSPGGQAPNIPGNPTGQGQGLRPGQGQGNQQQSPARTTAPGQPTQTGQ
ATQSGQPTSGQPTVTVTQTQSQCPAPGAPGSGGTPGSGGSGSDGGGSSPDGGDDSGAPSW
SYLVAEAAGVMAGRRRNGGGTKPTADQAWQMWDQAKEGNRSPAEAAGLKLNPDGTSADSD
YDIITVPKEDGDYQKLILMKNQNAPKQYRFPLNTPEGGRSEKNDDGSISVFDRNGEKVGQ
FNAPWAYDANGKEVPTWYDIEGDDMVQRIEPGPDNVYPIIADPLWDKIKSAGNSVKNFGA
GVGRSVADTVEGVGQMVTNPKETAKGMAPLVGLGGDGAPGVGESWGAVGKAFIAKDDFDR
GDTAYGAGKVLGNVLQTVVDPTKGAGKVASTAGKAAKAAKAAEEVAETSASTAAKTAGKA
AEKAADGAGDAAQVAGKTATNVAGDAASAGTQAASTAAQSAGKAAEAAGDAAGAAARGTD
SVGGGGSKTARALAEAAEEAVPPPGNILEISHPPAKWTPDQINQEIAKLVQLNIDSIIND
GLVVTKPVRSGFDKIKQTFLESLGTASTNPVGRFLVPKGWNVDHIIDLQLGGANALENLQ
LLNASVNQSMGIRIANAIKAAGFAEGDLISEIIWKGGESLVR
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
gtggcagcgcacgctcgggggaagcccgttcacgccgcgaacagcgacggtggtgacggg
gtggcgcaggagcgcctgcagggagcgttcctgacagtgatcggtgtggccgggatgttc
ggcggggtgatgttctccatcgaggcgccgcggttcactccggtgccggtggtgttcctg
acgttctggttgatcatggtgatcgtcggccggatcttcttcaccggtctgggcaagctc
cgctcggcgggtgtgggtgcgcccgcgccggagcaggtgcgcgctgcggctgcggtggcg
gggatcgtggtggcggtggggatgatgggcttcgcggcgacgggccccggtactggtgtt
gcttcggcggcgccgtgtcccggtggtgggccggcgacgtgtggtcctggtccggggccg
gagttgacgatcacgcctcctgcgcagcagaccactgctcccggtgggcagcagggtaat
caggggagcggtcaggacaacaacggcatcgcgacctcgcctgcgggcagcggcggcaac
aacggtgacggcattcaggcccagactcccgatttcggcagccccggtgggcaggcgccg
aacatccccggtaacccgacgggccagggccaggggctgcggcccggccaggggcagggg
aatcagcagcagagcccagcgcgcaccactgctcccggccagccgacccagacgggtcag
gcgacgcagtccggtcagcccacgtcgggccagccgacggtgacggtgacccagacccag
tcgcagtgccctgcccccggtgcaccaggtagtggcggcacgccgggcagcggcggttcg
ggatccgacgggggcggctccagccctgatggcggggacgacagtggcgcgccgtcatgg
tcctacctcgttgccgaggcagcgggtgtgatggcaggtcgccgacggaatggcggcggc
accaaaccgacggctgatcaggcgtggcagatgtgggaccaggccaaggaaggcaaccgc
agtcccgcagaggcggccggtctgaagctcaatcctgatggcaccagcgccgactcggac
tacgacatcatcaccgtcccgaaggaggacggcgactaccagaagctgattctgatgaag
aatcagaacgctcctaagcagtaccgcttccccctcaacacaccggaaggcggtcgttcg
gagaagaacgacgatggatcgatctccgtgttcgaccgtaacggcgagaaggtcgggcag
ttcaacgcaccgtgggcgtacgacgccaacggcaaggaggtgcccacctggtacgacatc
gaaggcgacgatatggtccagcgcatcgagcctggtccggacaacgtctacccgatcatc
gcggatccgttgtgggacaagatcaagagcgcgggaaacagcgtcaagaactttggtgcc
ggcgtaggcaggagtgttgccgacactgttgaaggcgttggtcagatggtcaccaacccc
aaggagaccgcgaagggaatggccccgctcgtcgggctcggaggcgatggtgcaccggga
gtcggagagtcgtggggtgcagttggtaaggcgttcatcgccaaggatgacttcgaccgc
ggtgacaccgcctacggcgcaggaaaggtcctgggcaacgtcctccagacggtcgtcgac
cctaccaagggtgctggcaaggtggcgtcgactgcgggtaaggcagccaaggccgcgaag
gccgctgaggaagtcgctgagacatcagccagtactgccgcgaagaccgccggcaaggct
gcggaaaaggctgcagacggagcgggtgatgcagctcaggtagcagggaagaccgcgacg
aacgtggctggtgatgcagcgagcgccggcactcaggcagcgtcgaccgctgcgcagtcg
gccggtaaggccgcggaggccgccggcgatgccgcgggcgcagcggcgcgtggcacagat
tcagttgggggcggaggatcaaagacggcacgtgcgctcgcagaggccgccgaagaagct
gttccacctccagggaatattctcgagatttctcatccgcccgcaaagtggactccagat
cagattaatcaggaaatcgccaagttggtgcagttgaatattgactcaattatcaacgac
ggacttgttgttaccaagcctgttcgatcggggttcgacaagataaagcagacattcctt
gaatcgctaggaactgcgtccacaaaccctgtggggagattcttggttccgaagggatgg
aatgtcgaccacatcatcgaccttcagctcggtggggcgaacgcgctcgagaacctccag
cttctcaacgcatcggtcaaccagagtatggggattcgaattgccaatgcgattaaggcc
gcggggttcgcggagggggatctcatctctgagattatttggaagggcggggaatcccta
gtacgctag

DBGET integrated database retrieval system