KEGG   Tsukamurella paurometabola: Tpau_0773Help
Entry
Tpau_0773         CDS       T01228                                 

Definition
short-chain dehydrogenase/reductase SDR
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
tpr  Tsukamurella paurometabola
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tpr00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Tpau_0773
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Tpau_0773
Enzymes [BR:tpr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Tpau_0773
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
790291..791022
Genome map
AA seq 243 aa AA seqDB search
MTRAFVTGGAAGIGAAIARRLAADGATVTVVDRDGPAAAGLAREIGGDHLELDLTDTDAL
AGLTLDVDILVNNAGVQHVAPIEEFDPGWFRRITTLMLEAPFLLTRAALPAMYERGFGRI
VHVSSVHGLRASKYKAAYVAAKHGVEGLSKVTALEGGPHGVTSNCVNPGYVRTALVATQI
AEQALAHGITEQQVTDEVFLARPAIKRLIEPDEVAGLVSWLCGPAAAMVTGASYAMDGGW
TAN
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgacccgagcgttcgtcaccggcggggcggccgggatcggcgcggcgatcgcgcggcgc
ctcgccgccgacggtgccacggtcaccgtcgtcgatcgggacggtccggccgctgccggg
ctggcccgggagatcggcggcgatcacctcgaactcgacctcaccgacacggatgcgctc
gccgggctcacgctcgatgtggacatcctggtcaacaacgccggtgtgcagcacgtcgcg
ccgatcgaggagttcgatcccgggtggttccgtcggatcaccacgctgatgctcgaggct
ccgttcctgttgacccgggccgccctgcccgcgatgtacgagcgcggcttcggccggatc
gtgcacgtctcctcggtgcacgggctgcgggcctcgaaatacaaagccgcctacgtggcc
gccaagcacggcgtcgagggcctgtcgaaggtgaccgcactggagggtgggccgcacggt
gtcaccagcaactgcgtgaaccccggctacgtccgcaccgctctcgttgccacgcagatc
gccgaacaggccctcgcgcatggcatcaccgagcagcaggtcaccgacgaggtcttcctg
gcccggcccgcgatcaagcggctcatcgagcccgacgaggtcgcgggcctggtgtcgtgg
ttgtgcggccccgcggcggcgatggtgaccggtgcgtcgtacgcgatggacggcggctgg
accgcgaactga

DBGET integrated database retrieval system