KEGG   Tsukamurella paurometabola: Tpau_0908Help
Entry
Tpau_0908         CDS       T01228                                 

Definition
FAD dependent oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
tpr  Tsukamurella paurometabola
Pathway
Steroid degradation
Brite
KEGG Orthology (KO) [BR:tpr00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Tpau_0908
Enzymes [BR:tpr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Tpau_0908
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
927633..929366
Genome map
AA seq 577 aa AA seqDB search
MAKQKTGDHFDVLVIGSGFGGSVTALRLTEKGYRVGVLEAGQRFEDEDFAETTWNLKKFL
WAPKLGCFGIQRIHLLNDAVVLAGAGVGGGSLNYANTLYKPPAPFFNDPQWKDITDWDDE
LSPFYDQARRMLGVVKNPHETPSDRVIKQIADEMGVGDTYVATPVGVYFNQPGRTDADPF
FGGAGPARTGCTECGQCMSGCRVGAKNTLMKNYIHLAEKGGARFIPMTTVTGVREGRKGV
WEIDTERTGAVARKNRTVYTADNVVFAAGTWGTQTLLHHLKDTGALPELSDRLGVLTRTN
SESILGSARTTVDPTEDLSQGVAITSSFYPRPDTHIEPVRYGPGRNAMGMLQSLLVDGGE
GRTRLAGFLKGLVRKPSDLKLLLTQKDWGQRVLILLVMQSLDNSITTYTKKIPGSKKRRM
VSKQGHGAPNPTWIPAGNEAARIGAEKLNGVAGGTWGDIFNVPMTAHFLGGAAISETPEQ
GVIDPYHRVHNYPSLFVVDGAAISANLGVNPSLSIAAQAERAASLWPNKGEQDPRPAQGT
GYQRIAPTAPVSPAVPEGAPGQLLLPLPKVRPTQPQA
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atggccaagcagaagacgggcgaccacttcgacgtactcgtgatcggttccggattcggc
ggcagcgtcacggcgctgcgcctgaccgagaaggggtaccgcgtcggcgtgctcgaagcg
gggcagcgattcgaggacgaggacttcgccgagaccacctggaacctcaagaagttcctc
tgggcgcccaagctcggctgcttcgggatccagcgcatccacctgctcaacgacgcggtg
gtgctcgccggcgccggtgtgggcggcggctcgctcaattacgcgaacacgctgtacaag
ccgccggccccgttcttcaacgacccgcagtggaaggacatcacggactgggacgacgag
ctcagcccgttctacgaccaggcccggcggatgctcggcgtggtgaagaacccgcacgag
accccgtcggaccgggtgatcaagcagatcgccgacgagatgggcgtgggcgatacctac
gtcgccacgccggtcggcgtgtacttcaatcagcccggccgcaccgacgccgaccccttc
ttcggcggcgccggtcccgcccgtacgggctgcaccgagtgcgggcagtgcatgtcgggt
tgccgcgtgggtgccaagaacaccctgatgaagaactacatccacctcgccgagaagggt
ggagcccgattcatcccgatgaccaccgtgaccggcgtgcgggagggtcgtaagggcgtg
tgggagatcgacaccgagcgcaccggtgcggtcgcccggaagaaccgcaccgtctacacc
gccgacaacgtggtcttcgccgccggcacctggggtacgcagaccctgctgcatcacctc
aaggacaccggcgcactgcccgagctgtccgaccggctcggggtgctcacccgcaccaac
tcggagtcgatcctcggttcggcgcgcaccacggtcgaccccaccgaggatctgtcccag
ggcgtcgcgatcaccagctccttctacccgcggcccgatacgcacatcgagcccgtccgg
tacggcccgggacgcaacgcgatgggcatgctgcaatcgctcctggtcgacggcggcgaa
gggcgtactcgcctcgcgggcttcctcaagggactggtgcgtaagcccagcgacttgaaa
ctgctgctgacccaaaaggactggggccagcgcgtgctgatcctgctggtgatgcagagc
ctcgacaactcgatcaccacgtacaccaagaagattcccggttcgaagaagcggcgcatg
gtctccaagcagggccacggcgcgccgaaccccacctggatcccggccgggaacgaggcc
gcgcggatcggcgcggagaagctcaacggtgtggccggtggcacctggggcgatatcttc
aacgtcccgatgacggcccacttcctcggcggcgcagcgatttcggagactccggaacag
ggtgtcatcgatccctatcaccgggtgcacaactatccgtcgctcttcgtggtggacggc
gccgccatctcggcgaacctcggtgtgaacccgtcgctgtcgatcgcggcgcaggccgag
cgggccgcctcgctgtggccgaacaagggcgagcaggatccccggcccgcgcaggggacc
ggttaccagcggatcgcgccgacggcgccggtctcgcccgctgtgcccgagggggcgccc
ggccagttgcttctgccgctgccgaaggtgcggccgacccagccgcaggcctga

DBGET integrated database retrieval system