KEGG   Tsukamurella paurometabola: Tpau_0966Help
Entry
Tpau_0966         CDS       T01228                                 

Definition
succinate dehydrogenase cytochrome b subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
tpr  Tsukamurella paurometabola
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:tpr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tpau_0966
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tpau_0966
   00650 Butanoate metabolism
    Tpau_0966
  Energy metabolism
   00190 Oxidative phosphorylation
    Tpau_0966
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(990243..990710)
Genome map
AA seq 155 aa AA seqDB search
MTTANEPKLAKTLLKQYDRPASLDNPRSPHRPTGGNFEKYAWLFMRFSGIALLVLVFGHV
FIMLALDSDGVHRINAAFVAQRWASPFWQIWDITMLWLAQLHGGNGLRVIIDDYAKKDRT
RFWLKALLVLSMILVVGLGSYALLTFEPASVPTAQ
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgactaccgcgaacgagcccaagctcgccaagacgctgctcaagcagtacgaccgcccc
gcctcgctcgacaacccccgctccccgcaccgtcccaccggcggcaacttcgagaagtac
gcatggctgttcatgcgcttctcgggcatcgccctgctggtgctggtcttcggccacgtt
ttcatcatgctggcgctcgacagcgacggcgtgcaccggatcaacgccgcgttcgtcgcg
cagcgctgggccagcccgttctggcagatctgggacatcaccatgctgtggctcgcccag
ttgcacggcggcaacggcctgcgcgtgatcatcgatgactacgccaagaaggaccgcacc
cgcttctggctcaaggcactgctcgtcctgtcgatgatcctcgtggtcggcctcggctcg
tacgcgctgctcacgttcgaaccggcctccgtgcccaccgcgcagtag

DBGET integrated database retrieval system