KEGG   Tsukamurella paurometabola: Tpau_0969Help
Entry
Tpau_0969         CDS       T01228                                 

Definition
pyrimidine-nucleoside phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
tpr  Tsukamurella paurometabola
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:tpr00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
991767..993065
Genome map
AA seq 432 aa AA seqDB search
MSEVFDAVSVIAAKRDGKALTDGQIDWVIDRFTSGEVADYQMSALAMAIFLNGMDRREIA
RWTAAMIASGERMDFSGLRRDGKPLATTDKHSTGGVGDKITLPLTPLVASYGVAVPQLSG
RGLGHTGGTLDKLEAIAGWRTDLTNEQMFDQLEKVGGVICAAGSGLAPADKKLYALRDVT
STVEAIPLIASSIMSKKIAEGTASLVLDVKVGKGAFMKTAAQARELAETMVALGHDSGVD
TVALLTDMSTPLGRSAGNGLEVAESLDVLAGGGPSDVVELTLALAKEMLALAGVDADPAE
HLANGKAMDSWKAMIAAQGGDPDAPLPVAQHTRTVPAPASGVLTELDAMGVGIAAWRLGA
GRERQGEPVQAGAGVTWHAGVGDTVTAGEPLFTLHTDTEEKFDGAIAALDGAAVIGETAA
PRGSLVLDRVTA
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagtcttcgatgcggtctcggtgatcgccgccaagcgcgacggtaaggccctc
accgacggccagatcgactgggtgatcgaccggttcaccagcggtgaggtggccgactac
cagatgtcggcgctggcgatggcgatcttcctcaacgggatggaccgccgtgagatcgcg
cgctggaccgcggccatgatcgccagcggcgagcggatggacttctccggactgcgccgc
gacggcaagcccctcgcgaccaccgacaagcactcgaccggcggcgtgggcgacaagatc
accctgccgctcacaccgctcgtcgcctcgtacggtgtcgccgtgccgcaactgtccggc
cgcggtctcggccacaccggcggcacgctggacaagctcgaggcgatcgcgggctggcgg
accgacctgaccaatgagcagatgttcgaccagctggagaaggtgggcggtgtgatctgt
gcggccggttcgggcctcgcacccgctgataagaagctctacgcgctgcgcgatgtcacc
agcacggtcgaggccatcccactgatcgccagctcgatcatgagcaagaagatcgccgag
ggcaccgcctcgctcgtgctcgacgtgaaggtgggtaagggcgccttcatgaagaccgca
gcgcaggcccgcgaactcgccgagaccatggtcgcgctcggccacgactccggcgtcgac
accgtcgccctcctcaccgacatgtccactccgctcggccgcagtgccggcaacggtctc
gaggtcgccgaatcgctcgacgtgctcgccggtgggggaccgtcggatgtggtggaactg
accctcgcgctcgcgaaggagatgctcgccctcgccggcgtcgacgccgaccccgcggag
cacctcgccaacggtaaggcgatggacagctggaaggcgatgatcgcggcccagggcggc
gaccccgacgcgccgctgcccgtcgcgcagcacacccgcaccgtccccgcgcccgcctcc
ggtgtgctcaccgaactcgatgcgatgggcgtcggcatcgccgcctggcgcctcggcgcg
ggccgcgagcggcagggcgagccggtgcaggccggcgcgggcgtcacctggcacgcgggc
gtcggcgacaccgtcaccgcaggggagccgctgttcacgctgcacaccgacaccgaagag
aagttcgacggcgcgatcgccgcgctcgacggggcggccgtgatcggcgagaccgccgcc
ccgcgcggttcgctggtcctcgaccgggtgacggcctag

DBGET integrated database retrieval system