KEGG   Tsukamurella paurometabola: Tpau_0998Help
Entry
Tpau_0998         CDS       T01228                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
tpr  Tsukamurella paurometabola
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tpr00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:tpr00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:tpr00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1020511..1023549
Genome map
AA seq 1012 aa AA seqDB search
MTFHLRDLADPEHFAEGTVAPHSDHRWFRNRDEALAGISSFEQSLNGMWKFDYAPNPQSA
PEGFERLDCDVDDWAEIEVPAHIQLQGYDRPQYVNVQYPWDGREQLEPGQVPMRFNPVGS
YVRTFELDAPLGPGERLTLHFAGVESALAVWVNGIYVGYAEDSFTPSEFDITDYLTSAEN
RIACRVFKWCSASWLEDQDLFRFSGIFRDVTLHRHPATHITDLVVSTDIADDFSTAEVSV
AVTLRGAGMVRGVLTGVGDLVSAGAGRLAVAVDSPQLWSSESPHLYDLVLEVSDDRGDVT
EIVPVKVGIRRVGIEDGVFKVNGRRVVFNGVNRHEFGLKGRVVTREETESDLRFMKAHNI
NAVRTSHYPNNTFFYELCDIYGVYVIDEVNLETHGTWADTPVLATPDTALPGDRPEWLDN
VRARARNMVARDRNHCSIVMWSCGNESSGGRNLLEVSRLLKAEDTRPVHYEGISMDPRYP
ETSDVVSRMYLPVDDVEAYLLEHRDKPYILCEYAHAMGNSFGAVDRYVDLAYRDELFQGG
FIWDFVDQALPARNADGSEYLGYGGDFGDRPNDADFSGNGILFADRSPKPCAEEVKRLYQ
GFVFTIGRSSVEIENRMMFTSSADFRCVAQLSYGGTIVEEAEIDTRVDAGSVGAYSLPFV
VDTAQLDAAVDVSLRLRTATDWAGADHVVAADQRVFPNRRRVPDGRPPQGSLELIEGRHN
IGVRGEGFDVLFSVLHGGLVSYRVGEGDTYRELLDSMPLPNFWHAPTSNERGWKMPARDG
MWLVASRYPRPDAGAGRTSVERADDGAVMVRCRYILPTSPESTCSVEYTVTPDGRVAVQV
DVDPAPGLPDMPEFGMSLALPAPYHRLTWFGDGPHECYVDRRAAARLGIHSIDTREALTP
YIRPQEAGNRTGVRWAEVTDEHGYGMRLEGRESMELAVTPWTPYEVENARHPEDLPPIRR
TILRPALMRRGVGGDDSWGSLPHPEYRLPAGQRMRFAFDFLGIAPEGRGTSG
NT seq 3039 nt NT seq  +upstreamnt  +downstreamnt
atgacctttcacctacgcgatctcgctgatcccgagcacttcgcggaggggaccgttgcc
ccccattcggaccatcgctggttccggaaccgagacgaggcgctggcggggatcagttcc
ttcgaacagagcctcaacggcatgtggaagttcgactatgcgccgaatccgcagtccgcg
cccgagggcttcgagcggctcgactgcgatgtcgacgactgggctgagatcgaggtcccc
gcgcacatccagttgcaggggtacgaccggccgcagtacgtcaacgtgcaatacccgtgg
gatgggcgcgagcagctcgaaccggggcaggtccccatgagattcaacccggtcgggtcg
tacgtgcggaccttcgagctcgacgcacccctcgggccgggggagcggctcacgctgcac
ttcgccggcgtggagagcgcgctggcggtgtgggtgaacgggatctacgtgggctacgcc
gaggactcgttcacaccctcggagttcgacatcaccgactacctgacgtcggccgagaac
cggatcgcgtgtcgcgtcttcaagtggtgctccgcctcgtggctcgaggaccaggacctc
ttccgcttctcgggcatcttccgtgatgtgactctgcaccgccacccggcgacgcacatc
accgacctggtcgtgtccaccgatatcgcagatgatttcagcacggccgaggtctcggtc
gccgtcacgcttcgcggagcgggaatggtccgcggcgtcctgaccggagtcggcgacctg
gtctcggcgggtgcgggccggctcgccgtcgcggtggactccccgcagctgtggagcagc
gaatcccctcacctctacgacctcgtactcgaggtgtccgacgaccgcggcgacgtgacc
gagatcgtgccggtgaaagtcggcatcaggcgcgtcggcatcgaagacggtgtgttcaag
gtcaacgggcgacgcgtggtgttcaacggcgtcaaccggcacgagttcggcctgaagggg
cgcgtggtcacccgcgaggagacggagtcggatctccgcttcatgaaggcgcacaacatc
aatgcggttcgcacgagccactaccccaacaacacgttcttctacgagctgtgcgacatc
tacggcgtgtacgtgatcgatgaggtcaacctggagacgcacgggacgtgggcggatacc
ccggtgctggcgacgccggacaccgcactgcccggcgaccgccccgagtggctggacaac
gtccgtgcccgcgcccgcaatatggtggcccgagaccgcaaccactgcagcatcgtgatg
tggtcgtgcggcaacgaatcctccgggggccggaatctcctcgaggtctctcggctcctc
aaagcggaggacacccgtccggtccactacgaggggatctccatggacccgcggtatccg
gagacgagcgacgtcgtcagcaggatgtacctacccgtggacgatgtcgaggcctatctg
ctggagcatcgcgataagccgtacatcctctgcgagtacgcccatgccatgggcaactcg
ttcggagcggtcgaccgatacgtcgacctcgcgtatcgcgacgagctcttccagggcgga
ttcatctgggacttcgtcgaccaagcactccccgcacggaacgcggacggcagtgagtac
ctcggttacggaggagacttcggtgaccgaccgaatgacgccgacttctccgggaacgga
atactgttcgccgacaggtcgcccaaaccgtgcgcggaagaagtcaaacgcctgtatcaa
ggcttcgtcttcacgatcggtcggtcgtcggtggagatcgagaaccgcatgatgttcacg
agttcggcggacttccgctgcgtcgcgcagctctcctacggggggaccatcgtcgaagag
gcggagatcgacacgcgtgtggacgccggctcggtcggcgcgtactcgctgccgttcgtc
gtcgacaccgcgcagctcgatgccgcggtcgacgtctcgctccggttgcgaacggccacc
gactgggccggtgcggatcatgtggtggccgctgaccagcgagtgttcccgaatcgccgt
cgtgtgcccgacggtcggccgccgcagggaagcctcgaactcatcgagggacgtcacaac
atcggtgtccggggcgagggcttcgacgtcctgttctcggtgctgcacggaggcctggtt
tcgtaccgcgtgggcgagggtgatacctatcgcgagctgctcgattccatgcctctgccg
aacttctggcacgcgcccacgtccaacgagcgaggctggaaaatgcctgcgcgggacggt
atgtggctcgtggcgagtcggtacccgcgccccgacgccggagcggggcgaacgtcagtg
gagagggccgacgacggcgcggtcatggtccgctgccgctacatcctgccgacctctccg
gagagcacgtgctcggtggagtacacagtgactcccgacgggagggtagcggtgcaagtg
gacgtcgaccccgctccgggccttcccgatatgccggagttcggtatgtcgttggcgctt
ccggcgccgtatcaccgcttgacctggttcggagacggaccccacgagtgctacgtcgat
cgtcgcgccgccgcgcgtctgggaatccattcgatcgacacccgcgaagcactgaccccc
tacatccgcccgcaggaagcggggaaccggacaggagtcagatgggccgaggtgaccgac
gagcacgggtacggaatgcgtctcgaggggcgcgagagcatggagctcgcggtcacgccg
tggacgccgtacgaggtggagaatgcccgtcaccccgaagacctcccgccgatccgccgc
acgatccttcgtccggcactgatgcgccggggagtgggcggtgacgattcgtggggatcg
ctgccccatccggagtaccgcctgcccgcggggcagcggatgcgattcgcgttcgacttc
ctcggtatcgccccagagggccgcgggacctccggttag

DBGET integrated database retrieval system