KEGG   Tsukamurella paurometabola: Tpau_1005Help
Entry
Tpau_1005         CDS       T01228                                 

Definition
carbohydrate kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tpr  Tsukamurella paurometabola
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tpr00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Tpau_1005
Enzymes [BR:tpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Tpau_1005
Exosome [BR:tpr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Tpau_1005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1028939..1029784)
Genome map
AA seq 281 aa AA seqDB search
MAVSHRDPQFVAAIDQGTSSTRCIIFDRGGTIVAAEQREHDQIFPRNGWVEHDATQIWVN
TRQVCAQALATADLTAADIAAVGITNQRETVVVWDRATGEPIYNAIVWQDTRTEAMCEEL
ASVGLDEPDRDRFKPSCGLPLASYFSGPKIAWILDTVPGARERAERGELCAGTIDSWLVW
NLTTDDAGSAEPGRPMHITDITNASRTMLMNLADGAWDPATCAAMGIPMAMLPEIRSSAE
VYGVVRERGVFGGVPIAGILGDQQAAMFGQAALDEGGLLHG
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
gtggcagtttcccatcgtgacccgcagttcgtcgccgccatcgatcagggcaccagttcc
acccggtgcatcatcttcgatcggggcggcaccatcgtggccgccgaacaacgggagcac
gaccagatcttcccacgtaacggctgggtcgagcacgacgccacgcagatatgggtcaat
acgcgacaggtgtgcgcacaagccctggcgacggccgatctcaccgcggcggacatcgcc
gcggtcggcatcaccaaccaacgcgagacggtcgtggtgtgggatcgcgcgacgggcgaa
ccgatctacaacgcgatcgtgtggcaggacacgcggacggaggcgatgtgcgaggaactg
gcgtccgtcgggctcgatgagcccgaccgcgaccggttcaagccctcctgcggcttgccc
ctcgcctcgtacttctccgggccgaagatcgcctggatcctcgacaccgtgccgggcgcc
cgcgagcgggccgaacgcggcgaactgtgcgcgggcaccatcgactcgtggctggtgtgg
aatctgaccaccgacgatgccgggagcgccgagccaggccggccgatgcacatcaccgac
atcacgaacgcctcgcgcaccatgctgatgaatctggccgacggcgcgtgggacccggcc
acctgcgccgccatgggcattcccatggcgatgctgcccgagatccgctccagtgccgag
gtgtacggcgtggtgcgcgagcggggcgtgttcggtggagtgccgatcgcgggcatcctc
ggcgaccagcaggccgcgatgttcggacaggccgcgctcgacgaggggggcctgctgcac
gggtag

DBGET integrated database retrieval system