KEGG   Tsukamurella paurometabola: Tpau_1231Help
Entry
Tpau_1231         CDS       T01228                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tpr  Tsukamurella paurometabola
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tpr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tpau_1231
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tpau_1231
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Tpau_1231
Enzymes [BR:tpr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Tpau_1231
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1263153..1264253
Genome map
AA seq 366 aa AA seqDB search
MTSSNVGAVHTPWPGLIEAYRHRLPVCDTWEPGWEPVTLREGATPLLPAKSLSERTGCEV
YLKVEGLNPTGSFKDRGMTMAVTEAKATGKKGVLCASTGNTSASAAAYASIAGIECAVLV
PAGKIAMGKLAQAVMYGAKIIEVDGNFDDCLELARKTTATFDTIALVNSVNPVRIEGQKT
AAFEIVDALGKAPDVHALPVGNAGNITAYWKGYSEYFADGVIAARPRMLGVQAAGAAPLV
GGAPVKNPETIATAIRIGSPASWNQAVAAKDESNGQFRAATDEKLLEAYRLVARTEGVFV
EPASAASVAGLLAATEDGWIEKGSTVVCTVTGNGLKDPDTALKGVPEIARVGIDPVAVAA
AMGLTE
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgactagcagcaacgtcggagccgtgcatacgccctggccgggcctcatcgaggcgtac
cgtcaccgccttcccgtgtgcgacacctgggagccggggtgggagccggtgaccctccgc
gagggtgcgacgccgctgctgccggcgaaatcgctgtccgaacgcaccggctgcgaggtg
tacctcaaggtcgaggggctcaaccccaccggctcgttcaaggaccgcggcatgacgatg
gcggtcaccgaggccaaggccaccgggaagaagggcgtgctgtgcgcgtccaccggcaac
acctccgcttccgcggcggcgtacgcgtccatcgccggcatcgaatgcgccgtgctggtg
cccgcgggcaagatcgccatgggcaagctggcccaggccgtgatgtacggcgccaagatc
atcgaagtcgacggtaacttcgacgactgcctcgaactcgcccgcaagaccaccgccacg
ttcgacaccatcgcgctggtgaactcggtgaacccggtgcgcatcgaggggcagaagacc
gcggcgtttgagatcgtcgacgcgctcggcaaggcccccgacgtgcacgcgctgcccgtg
ggcaacgccggcaacatcaccgcgtactggaagggctacagcgagtacttcgccgacggc
gtgatcgcggctcgtccgcgcatgctgggcgtgcaggccgcgggcgccgcgccactggtg
ggcggcgccccggtcaagaacccggagaccatcgcgaccgccatccgtatcggcagccca
gcgtcgtggaatcaggctgtcgccgccaaggatgagtcgaacggccagttccgtgccgcc
accgacgagaagctgcttgaggcctatcgcctggtcgcgcggaccgagggggtcttcgtc
gagcccgcctctgcggcatcggtcgccggactgctcgccgccaccgaggacggctggatc
gagaagggctccaccgtggtgtgcactgtgaccggcaacggcctcaaggatcccgatacc
gcgctgaagggcgtgccggagatcgcgcgcgtcggcatcgaccccgtggccgtcgccgcc
gccatgggcctgacggagtag

DBGET integrated database retrieval system