KEGG   Tsukamurella paurometabola: Tpau_1259Help
Entry
Tpau_1259         CDS       T01228                                 

Definition
UDP-N-acetylglucosamine1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
tpr  Tsukamurella paurometabola
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:tpr00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:tpr00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1292149..1293402
Genome map
AA seq 417 aa AA seqDB search
MGEKFLVHGGARLTGEVTVGGAKNSVLKLMAAALLAEGTSVLTNCPEILDVPLMADVLRG
LGAEVELDGETARITTPAVLNHRADFDAVKQFRASVCVLGPLMAREHRAVVALPGGDAIG
SRPLDMHQSGLRALGATSSIEHGCVVAQADSLVGAEITLEFPSVGATENILMAAVLAKGL
TVISNVAREPEIVDLCTMLVQMGADIEGVGTDTLMVRGVDKLHPTEHRVIGDRIVAATWG
FAAVMTRGDITVNGIAPETLGVVLQKLQDAGATVTERADGFRIASPERPHAVNVATLPFP
GFPTDLQPMAIGMACVADGTSMITENVFEARFRFVEEMVRLGADARTDGHHAVIRGVEQL
SSAPVWSTDIRAGVGLVLAGLCADGVTEVHDVFHIDRGYPNFVGTLTALGGRIERVS
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
gtgggtgagaagtttctggtgcacggcggagcccgattgaccggcgaggttaccgtgggc
ggagcgaagaacagcgtgctcaagctcatggcggcggcattgctcgcggagggcacgtcg
gtcctgacgaactgtcccgagatcctggacgtaccgctcatggcggacgtgctgcgcgga
ctgggcgccgaggtggagctggacggtgagaccgcgcggatcaccacgccggcggtgctg
aaccaccgcgcggatttcgacgcggtcaagcagttccgcgcttcggtctgtgtactcggt
ccgctgatggcgcgtgagcaccgcgcggtggttgcgcttcccggcggagatgcgatcggc
tcgcggccgctcgatatgcatcagtcgggcctgcgcgcgctcggcgccaccagctccatc
gaacacggttgcgttgtggcacaagcagattcgttggtcggtgcggagatcaccctggag
ttcccctcggtgggggccaccgagaacatcctgatggccgcggtcctggcgaaggggctg
acggtgatcagcaatgtcgcgcgggaaccggagatcgtggacctgtgcacgatgctcgtg
cagatgggggccgatatcgagggagtcggtaccgacaccttgatggtgcgcggcgtcgac
aagctccatcccacggagcaccgggtgatcggcgaccgcatcgtggctgcgacgtgggga
ttcgccgcagtgatgacgcgcggtgacatcacggtcaacggtatcgcgcccgagaccctg
ggggtggtgctgcagaagctccaggacgccggagccaccgtgaccgagcgcgcggacggc
ttccggatcgcatccccggagcggccgcatgcggtgaacgtggcgactctgcccttcccc
ggattccccacggacctgcagccgatggcgatcggtatggcgtgcgtcgcggacggtacg
tcgatgatcaccgagaacgtcttcgaggcgcgcttccggttcgtcgaagagatggtgcgt
ctgggtgcggatgcccggaccgatggccatcacgcggtgatccggggagtggagcagctc
tcgagtgcgccggtctggtcgaccgacatccgcgccggcgtcggcctggtgctggccggt
ctgtgcgccgacggggtgaccgaggtgcacgacgtcttccatatcgaccgcggatatccg
aacttcgtgggcacgttgaccgccctgggcggccggatcgagcgcgtgtcctga

DBGET integrated database retrieval system