KEGG   Tsukamurella paurometabola: Tpau_1377Help
Entry
Tpau_1377         CDS       T01228                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
tpr  Tsukamurella paurometabola
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:tpr00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1441481..1442617
Genome map
AA seq 378 aa AA seqDB search
MTGPTTEASATPLLGFTVAVTAARRADELSTLLIRRGAAVVAAPAISMVPLSDDVRLRAA
TDELLTAPPDLLVATTGIGFRGWLEAAEGWGVAEGLVAALGGGRVISRGPKATGALRAAG
LREEWSPKSESSAEVLSHLAGEDLHGQRVAVQLHGATDDWDPNPGLLDGLRDLGAEIVPV
PVYRWEQPEDLSGLDRIVEAIALAEVDAVTFTSAPAAASLLERAVELGVADSVRAALTGP
VVAYCVGPVTATPLQREGIESVTPERMRLGALARLVEQDLPGRRPDLRVAGHSLGLRARG
AVVDGAERDLTPTSITLLRLLAREPGDVVSRDELLAALGGDDPHAVEAAVARLRTGLGHK
EIIATVVKRGYRLALDEH
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaccggtccgacgaccgaggcctcggccaccccacttctcggcttcaccgtggccgtg
accgccgcccgccgcgccgacgagctgtccactctgctcatccggcgcggcgccgccgtg
gtcgcggcccccgcgatcagcatggtgccgctgtccgatgatgtgcggttgcgcgccgcc
acggacgagttgctcacggcaccaccggacctgctcgtcgccaccaccggcatcggtttc
cgcggctggctggaggccgccgagggctggggcgtcgcggagggcctcgtggccgccctt
ggcggcggccgggtgatctcccgcggacccaaggccaccggcgctctgcgcgccgccggt
ttgcgcgaggagtggtcgcccaaatcggaatcgtcggcggaggtgctcagtcacctcgcg
ggggaggatctgcacgggcagcgggtcgccgtccagctgcacggcgcgaccgacgactgg
gaccccaacccgggtttgctcgacggactgcgggacctgggcgcggagatcgtgccggtg
cccgtgtaccggtgggagcagccggaggacttatcgggcctcgaccgcatcgtcgaggcg
atcgctctcgccgaggtcgacgccgtcaccttcacttctgctcctgccgcggcctcgctg
ttggagcgtgccgtcgagctcggcgtcgccgactcggtgcgcgccgccctcaccggcccg
gtggtggcgtactgcgtggggccggtcaccgcgaccccgctgcagcgtgaggggatcgaa
tcggtgacccccgagcggatgcggctcggcgccctggcacggctggtcgaacaggacctt
ccgggccgcaggccggacctgcgggtggccgggcacagcctcggactacgcgcgcgcggc
gccgtcgtcgacggtgccgaacgcgacctcacgcccacctcgatcaccctgctccgcctg
ctcgcgcgcgagcccggcgatgtggtctcccgcgacgagttgctcgccgcgctcggcgga
gacgatccgcacgccgtcgaggcggccgtcgcccggttgcgaaccgggctgggccacaag
gagatcatcgcgacggtggtcaagcggggataccggcttgcgctcgacgagcactga

DBGET integrated database retrieval system