KEGG   Tsukamurella paurometabola: Tpau_1377Help
Entry
Tpau_1377         CDS       T01228                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
tpr  Tsukamurella paurometabola
Pathway
tpr00860  Porphyrin and chlorophyll metabolism
tpr01100  Metabolic pathways
tpr01110  Biosynthesis of secondary metabolites
tpr01120  Microbial metabolism in diverse environments
Module
tpr_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:tpr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Tpau_1377
Enzymes [BR:tpr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Tpau_1377
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: ADG78005
UniProt: D5UWY3
Position
1441481..1442617
Genome map
AA seq 378 aa AA seqDB search
MTGPTTEASATPLLGFTVAVTAARRADELSTLLIRRGAAVVAAPAISMVPLSDDVRLRAA
TDELLTAPPDLLVATTGIGFRGWLEAAEGWGVAEGLVAALGGGRVISRGPKATGALRAAG
LREEWSPKSESSAEVLSHLAGEDLHGQRVAVQLHGATDDWDPNPGLLDGLRDLGAEIVPV
PVYRWEQPEDLSGLDRIVEAIALAEVDAVTFTSAPAAASLLERAVELGVADSVRAALTGP
VVAYCVGPVTATPLQREGIESVTPERMRLGALARLVEQDLPGRRPDLRVAGHSLGLRARG
AVVDGAERDLTPTSITLLRLLAREPGDVVSRDELLAALGGDDPHAVEAAVARLRTGLGHK
EIIATVVKRGYRLALDEH
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaccggtccgacgaccgaggcctcggccaccccacttctcggcttcaccgtggccgtg
accgccgcccgccgcgccgacgagctgtccactctgctcatccggcgcggcgccgccgtg
gtcgcggcccccgcgatcagcatggtgccgctgtccgatgatgtgcggttgcgcgccgcc
acggacgagttgctcacggcaccaccggacctgctcgtcgccaccaccggcatcggtttc
cgcggctggctggaggccgccgagggctggggcgtcgcggagggcctcgtggccgccctt
ggcggcggccgggtgatctcccgcggacccaaggccaccggcgctctgcgcgccgccggt
ttgcgcgaggagtggtcgcccaaatcggaatcgtcggcggaggtgctcagtcacctcgcg
ggggaggatctgcacgggcagcgggtcgccgtccagctgcacggcgcgaccgacgactgg
gaccccaacccgggtttgctcgacggactgcgggacctgggcgcggagatcgtgccggtg
cccgtgtaccggtgggagcagccggaggacttatcgggcctcgaccgcatcgtcgaggcg
atcgctctcgccgaggtcgacgccgtcaccttcacttctgctcctgccgcggcctcgctg
ttggagcgtgccgtcgagctcggcgtcgccgactcggtgcgcgccgccctcaccggcccg
gtggtggcgtactgcgtggggccggtcaccgcgaccccgctgcagcgtgaggggatcgaa
tcggtgacccccgagcggatgcggctcggcgccctggcacggctggtcgaacaggacctt
ccgggccgcaggccggacctgcgggtggccgggcacagcctcggactacgcgcgcgcggc
gccgtcgtcgacggtgccgaacgcgacctcacgcccacctcgatcaccctgctccgcctg
ctcgcgcgcgagcccggcgatgtggtctcccgcgacgagttgctcgccgcgctcggcgga
gacgatccgcacgccgtcgaggcggccgtcgcccggttgcgaaccgggctgggccacaag
gagatcatcgcgacggtggtcaagcggggataccggcttgcgctcgacgagcactga

DBGET integrated database retrieval system