KEGG   Tsukamurella paurometabola: Tpau_1476Help
Entry
Tpau_1476         CDS       T01228                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
tpr  Tsukamurella paurometabola
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:tpr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tpau_1476
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Tpau_1476
Enzymes [BR:tpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Tpau_1476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1543887..1545020
Genome map
AA seq 377 aa AA seqDB search
MTAAPAADLAVGDVRAAVAGARKLVVKIGSSALTDLEHGLASDRLDALTDAIAARLDRGT
EVIVVSSGAIGAGMAPLGLKRRPTDLATKQAVASVGQLQLANAWGASFRRYDRIVSLVLL
TAHDVGLRVHAANAQRTLDRLRTLGAIPIINENDVVASNEVRFGDNDRLAALVAHLTGAD
ALVLLSDVDGLYDGDPRKGDASLIGAVDGPEDLDGVVAGSGGALGTGGMASKLSAARLAA
DAGVPVLLTAAALADRALDGADVGTVFRPRATRLSARRFWVRHAADVNGDLVLDDGAVAA
VVDRRRSLLPAGVTAVTGGFSGGDVVNLCDTEGIVRARGVVAYDASELEAMLGQGTGDLP
PDMRRPVVHADDLVPVR
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgacggcggcacccgccgccgatctcgccgtgggggacgtgcgtgccgcggtcgcgggt
gcccgcaaactggtcgtgaagatcggcagctcagcactcaccgatctggagcacgggctc
gcgtccgaccgtctcgacgcgctgaccgacgcgatcgcggcgcggctcgaccgcgggacc
gaggtgatcgtggtgtcctcgggcgcgatcggcgccggtatggcaccgctcggtctcaag
cggcgcccgaccgacctcgcgaccaagcaggcggtggcctccgtcggacagttgcagctc
gcgaacgcctggggtgcttccttccggcgctacgaccggatcgtgtcgctggtgctgctc
accgcgcacgatgtgggcctgcgcgtgcacgctgcgaatgcgcaacgcaccctggaccga
ctgcgcaccctgggtgcgatcccgatcatcaacgagaacgacgtggtggcttcgaacgaa
gtccggttcggcgataacgatcgactcgccgcattggtcgcgcatctgacgggggccgac
gcgctggtgttgctctccgatgtggacggcctgtacgacggtgacccgcgcaagggcgat
gcctcgctgatcggtgccgtcgacggccctgaggacctcgacggggtggtcgccgggtcg
gggggcgcactcggtaccggtggtatggcctcgaagctgtccgccgcccggctcgcggcc
gatgcgggcgtcccggttctgctcaccgccgcggcgctcgccgaccgggccctcgacggc
gccgatgtgggcacggtcttccggccccgcgcgacccgcctgtccgcgcgccggttctgg
gtgcggcacgcggccgacgtgaatggagacctggttttggacgacggggcggtggccgcc
gtggtcgatcgccgccgctcgctgctgcccgcgggtgtgaccgcggtgaccgggggattc
tccggcggcgatgtggtgaacctctgcgataccgagggcattgtccgcgcccgtggcgtg
gtggcgtacgacgcttccgagctggaggcgatgctggggcagggcaccggcgatctgccg
ccggacatgcgccggccagtggtgcacgcagacgatctggtccctgtgcgctga

DBGET integrated database retrieval system