KEGG   Tsukamurella paurometabola: Tpau_1517Help
Entry
Tpau_1517         CDS       T01228                                 

Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tpr  Tsukamurella paurometabola
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tpr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tpau_1517
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tpau_1517
  Amino acid metabolism
   00310 Lysine degradation
    Tpau_1517
Enzymes [BR:tpr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Tpau_1517
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1586312..1588072)
Genome map
AA seq 586 aa AA seqDB search
MAFSVQMPALGESVTEGTVTRWLKQEGDTVTVDEPLLEVSTDKVDTEIPAPASGVLLKIL
AQEDDVVEVGGDLAQIGEAGEAPAPAADPAPAAEAPAPAPEASAPAAPEAPAAPAEPAAP
AASSAPASGTEVTMPELGESVTEGTVTRWLKGIGDEVAVDEPLLEVSTDKVDTEIPSPVA
GTLLEIKANEDDVIAVGGVLAIVGSGAPAAPAAPAPEPAPAPEPAPAPEPAPAPTPAPAP
EPAPAAPAAAAPAPAAPAAPAAPAASAAPAASDSTPYVTPLVRKLAAENGVDLNAVKGTG
VGGRIRKQDVLAAAEASKAPAAPATAPAASAPAPSAPKGARPELAELRGTTQKTNRIRQI
TAKVTRDSLQQSAQLTQVFEVDFSKIVALRAKAKASFAAKEGVNLTYLPFIAKAVIEALK
VHPNVNATISDDFKEITYHGVVNLGIAVDTPQGLLSPVIKNADDLSLAGLARAIADLASR
TRNSGLKPDELSGGTFTITNIGSEGALFDTPILVPPQAAMLGTGAIVKRPVVVTDASGTE
SIGIHPMAFLPLTYDHRLIDGADAGRFLTTVKHRLEEGAFEADLGL
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atggccttctccgtccagatgccggcactcggcgagagcgtcaccgagggcaccgtcacc
cggtggctcaagcaggagggcgacaccgtcaccgtcgacgagcccctgctcgaggtctcg
accgacaaggtcgacaccgagatccccgctccggcatcaggcgttctgctgaagatcctg
gcccaggaggacgatgtcgtcgaggtcggtggcgatctcgcgcagatcggtgaggccggc
gaggcccccgctcccgccgcggatccggcgcccgccgccgaagctccggcgcccgccccc
gaggcctcggcaccggctgctcccgaggccccggctgcccccgccgagcctgcggccccc
gccgcatcgtcggcgcccgcgtccggcaccgaggtgacgatgcccgagttgggcgagtcg
gtcaccgaaggcaccgtcacccggtggctcaagggcatcggcgacgaggtggcggtcgat
gagccgctccttgaggtctccaccgacaaggtcgataccgagatcccctcgcccgtcgcc
ggcacgctgctggagatcaaggccaacgaagacgacgtgatcgccgtcggcggcgtgctc
gccatcgtgggcagcggcgctccggccgcacctgccgccccggcccccgagccggctccg
gcccccgagccggctccggctcccgagcccgctccagctcccacgcccgctccggcccct
gagcccgctcctgctgcgcccgcggcggcagctccggcacccgctgctcccgccgcaccc
gccgctccggcggcgtccgctgctccggcggcgtccgactcgaccccgtacgtcaccccg
ctggtgcggaaactggccgcggagaacggcgtcgacctgaacgcggtgaagggcaccggt
gtcggtggccgcatccgcaagcaggacgtgctggccgccgccgaggcgtccaaggctccg
gccgcacctgccaccgccccggccgcgtcggcgcccgccccgtccgccccgaagggtgcg
cgccccgagctggccgagctgcgtggcaccacccagaagaccaaccgcatccgtcagatc
accgcgaaggtgacccgcgactcgctgcagcagtccgcgcagctcacgcaggtcttcgag
gtggacttcagcaagatcgtggcgctgcgcgccaaggcgaaggcgagtttcgcggcgaag
gagggtgtgaatctcacgtacctgccgttcatcgcgaaggccgtcatcgaggcgctcaag
gtgcacccgaacgtgaacgcgacgatcagcgacgatttcaaggagatcacctaccacggt
gtggtgaacctcggcatcgccgtcgatacgccacagggcctgctgtcgccggtcatcaag
aacgccgacgatctgtcgctggcaggtctggcccgcgcgatcgcggacctggccagccgc
acccgcaacagtggtctcaagcccgacgagctgtccggcggcaccttcaccatcaccaac
atcggcagtgagggcgctctcttcgataccccgatcctggtcccgccgcaggcggcgatg
ctgggtaccggcgcgatcgtcaagcgcccggtcgtggtgacggacgcctccggtaccgag
tccatcggcatccacccgatggccttcctgccgctcacctacgatcaccggctcatcgac
ggtgccgacgccggtcgcttcttgaccaccgtcaagcaccggctcgaggagggtgcgttc
gaggccgacctcggcctctag

DBGET integrated database retrieval system