KEGG   Tsukamurella paurometabola: Tpau_1536Help
Entry
Tpau_1536         CDS       T01228                                 

Definition
(GenBank) asparagine synthase (glutamine-hydrolyzing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
tpr  Tsukamurella paurometabola
Pathway
tpr00250  Alanine, aspartate and glutamate metabolism
tpr01100  Metabolic pathways
tpr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tpr00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Tpau_1536
Enzymes [BR:tpr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Tpau_1536
Peptidases [BR:tpr01002]
 Cysteine Peptidases
  Family C44
   Tpau_1536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 QueC DUF3700 NAD_synthase
Motif
Other DBs
NCBI-ProteinID: ADG78159
UniProt: D5UY52
Position
complement(1606119..1608083)
Genome map
AA seq 654 aa AA seqDB search
MCGLLGFLSANQHAGDVVDAVTAAGRCMRHRGPDEFGGAWHDDDLALSFNRLSFIDIEHA
HQPLRWGPPENPDRYALTFNGEIYNYLELREQLTQEFGAQFRTEGDGEPIVAGFHYWGIA
GVLGRLRGMFAFAIWDTDKRELTLARDPFGIKPLYVATGTNGTVFSSEKKSVLDLAEVAG
LRPGLDPRAVQHYTVLQYVPEPESLHLGIRRLESGCYATVVPGGDVEGVRYFEPTFPVKP
VSGGLESAEAKAVYRDIADALRDSVKMHMRADVTVGSFLSGGIDSTAVAALAIQHNPDLI
TITTGFERDGYSEIDVAAESAEAIGARHVVKVVSPEEFRDAIPAIVWYLDDPVADPSLVP
LYYLAKEARKHVKVVLSGEGADELFGGYTIYKEPLSLAPFDKLPGWARRAAGRIGDRMPE
GQRGKSLLQRGSLALGDRYYGNARSFNDAQLQSVLRDFRPEWTHTDVTAPIYAKTRGWGP
VERMQHLDQFTWLRGDILVKADKMTMANSLELRVPFLDKEVFRVAETLPADLKLAGGTSK
YALRRALEEIIPPHVLHRKKLGFPVPLRHWLAGPELYDWARVTIEDSQTDEWIDRRAVLA
MLDEHRAKAPEGWPGGTDHSRRIWTVLMFMVWHGIFVEDRIHPAIEEPDYPVRL
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
gtgtgtggcctcttgggattcctgtccgcgaaccagcacgcgggcgatgtcgtcgacgcg
gtgaccgcggcgggccggtgcatgcggcaccgcggcccggacgagttcggtggcgcgtgg
cacgacgacgatctggccctgtcgttcaaccggctctccttcatcgacatcgagcacgcc
catcagccgctgcgctggggaccgccggagaatcccgaccgctacgccctcaccttcaac
ggcgagatctacaactacctcgagttgcgggagcaactgacgcaggagttcggggcgcag
ttccgcaccgagggcgacggtgagccgatcgtcgccggcttccactactggggcatcgcg
ggcgtcctcggccgtctgcggggaatgttcgctttcgcgatctgggacaccgacaagcgc
gagctgacgctcgcccgcgatccgttcggcatcaaaccgctgtacgtggcgaccgggacc
aacggcaccgtcttctccagcgagaagaagtcggtgctcgatctggccgaggtcgcgggt
ctgcggccgggcctggatccgcgggccgtgcagcactacaccgtgctgcagtacgtcccc
gaacccgaatccctgcacctgggcatccgtcggctggagtccgggtgctacgccaccgtc
gtgcccggcggcgatgtcgagggcgtgcggtacttcgagccgacgttcccggtgaagccg
gtgtcgggcgggttggagtcggccgaggcgaaggccgtgtatcgcgatatcgccgatgct
ctgcgcgattcggtgaagatgcacatgcgcgctgatgtgaccgtgggctcgttcctctcc
ggcggcatcgattcgaccgcggtcgcggccctggcgatccagcacaacccggacctgatc
acgatcaccacgggtttcgagcgggacggctacagcgagatcgacgtggcggcggagtcg
gcggaggcgatcggcgcccggcacgtggtgaaggtggtctcccccgaggagttccgcgac
gcgatccccgccatcgtctggtacctcgacgatccggtggccgatccttcgctggtcccg
ctgtactaccttgcgaaggaggcccgcaagcacgtcaaggtggtgctctccggcgagggc
gccgacgagctcttcggcgggtacaccatctacaaggaaccgctttcgctggcgcccttc
gacaagctgcccggctgggcgcgtcgtgccgcgggccgcatcggtgaccggatgcccgag
gggcagcgtggtaagtcgctgctgcagcgcggttcgctggcgttgggggaccgctactac
ggcaacgcccgttcgttcaacgacgcccagttgcagtcggtgctgcgcgatttccggccg
gagtggacgcacaccgacgtgaccgcgccgatctacgcgaagacccgcggttggggcccc
gtcgagcggatgcagcacctggaccagttcacctggctccgcggcgacatcctggtcaag
gccgacaagatgaccatggccaattcactggagctgcgcgtgccgttcctggacaaggag
gtcttccgggtggcggaaacgttgcccgcggacctcaagctggccggcggcacctcgaag
tacgcactgcgccgtgcgctggaggagatcatcccgccgcacgtgttgcaccggaagaag
ctgggcttccccgtcccactgcgacattggctggcgggcccggaactgtacgactgggcg
cgggtgacgatcgaggattcgcagaccgacgagtggatcgatcggcgcgcggtgctggcg
atgctcgacgagcaccgggcgaaggcgccggagggctggcccggcggtaccgatcattcc
cgccgaatctggaccgtgctgatgttcatggtgtggcacggcatcttcgtcgaggaccgc
atccacccggcgatcgaggaaccggactacccggtccggctctag

DBGET integrated database retrieval system