KEGG   Tsukamurella paurometabola: Tpau_1682Help
Entry
Tpau_1682         CDS       T01228                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
tpr  Tsukamurella paurometabola
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tpr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Tpau_1682
Enzymes [BR:tpr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Tpau_1682
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1752067..1753209
Genome map
AA seq 380 aa AA seqDB search
MTTRVLILGSTGSIGTQALEVIAANPDRFEVVGLGAGGGNPDLLAEQARATGLDGARIGI
ADPSRAAAFDGALTGPDAMTRLVETIDADVVLNGVVGSLGLGPTLAALDSGARLALANKE
SLVAGGSLVLGRAAPGQIVPVDSEHSAIAQCLRGGSAAEVDRLVLTASGGPFFGRTRAEL
ADVTPEQAAQHPTWSMGQMITLNSATLVNKALEVIEAHLLFGVPYDRIDVTVHRQSVVHS
MVTFVDGATIAKASPPSMKLPIALALGWPDRVPGASVACDFSQAHTWTFAPVDDQTFPAI
AVARDAGTRGGSLTAVFNAANEVVAQAFLDGRTSFLAIVDTVAQVVSDGAQWQAEPRDVA
DVLAAEDWARARAAELVGLA
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacccgcgtcctcatcctcggcagcaccggttccatcggcacccaggccctggag
gtgatcgccgcgaaccccgatcggttcgaggtggtcggcctcggggccggcggtggcaac
ccggacctgctggccgagcaggcccgcgccacgggcctcgatggcgcccgcatcggcatc
gccgacccctcgcgagcggcggccttcgacggtgcgctcaccggaccggacgccatgacc
cggctcgtggagaccatcgatgccgacgtcgtgctcaacggcgtcgtcggcagcctcggc
ctcggtcccactctcgcggctctcgacagcggtgcacggctcgccctcgccaacaaggag
tcgctggtcgcgggcggctcgctggtgctggggcgcgccgcgcccggccagatcgtgccc
gtcgattccgaacactccgccatcgctcagtgcctgcgcggcggctcggcggccgaggtc
gaccgcctcgtcctcaccgcatccggtggtcccttcttcggccgcacccgagccgaactc
gctgatgtcacgcccgagcaggccgcccagcaccccacctggtcgatggggcagatgatc
acgctcaactcggcgacgctggtgaacaaggccctcgaagtcatcgaggcgcacctgctg
ttcggtgttccctacgaccgcatcgacgtcaccgtgcaccgtcagtcggtggtgcactcg
atggtcaccttcgtcgacggggcgaccatcgcgaaggcgtcgccgccgtcgatgaagctg
ccgatcgccctcgcgctcggctggcccgaccgagtgccgggcgcctccgtggcctgcgac
ttcagccaggcgcacacctggaccttcgctccggtcgacgaccagaccttccccgcgatc
gcggtcgcgcgcgacgccggtacccgcggcggcagcctgaccgcggtgttcaacgccgcc
aacgaggtggtcgcgcaggcctttctcgacggccgcacctccttcctcgccatcgtcgac
acggtggctcaggtggtgtccgacggtgcccagtggcaggccgagccgcgggacgtggcc
gatgtgctcgccgcggaggactgggcccgtgcccgcgccgcagaactcgtggggctcgcc
tga

DBGET integrated database retrieval system