KEGG   Tsukamurella paurometabola: Tpau_1700Help
Entry
Tpau_1700         CDS       T01228                                 

Definition
sigma 54 interacting domain-containing protein
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
tpr  Tsukamurella paurometabola
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:tpr00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1770056..1771912
Genome map
AA seq 618 aa AA seqDB search
MSDRYPFSAVVGHDELRLALTLCAIAPAVGGVLVRGEKGTAKSTAARALAPLLPPRPDGA
DARLVELPIGATEDRVVGSLDLHRALGEGAVDFTPGLLADADGGILYVDEVNLLSDHLVD
VLLDAAAMGRVTVERDAVSRSYPARFVLVGTMNPEEGELRPQLLDRFGLAVDVRASREVD
VRVEVMRRRLAFESDPAGFAAEYAAADTALADRIATARERLPRVTLPDAELRRIAAVCAA
FDVDGMRADLVIARAALAHAAWRGVDEVTEDDVRVAAALALPHRKRRDPFDEPGLDDQEL
DRAFDDARQNEDPDPDTDPDGPDDPEGGGEPSDPTPPQPDSAGDDRPGTPEGGTLPTARH
RTVAKLSVPGLGTGGAAGRRSKARSDRGSVVRAAPAGTGSGLHLVATLRAAALNQGSRGR
SSGPLRLAREDLRAPIREATEGNLVVFVVDLSGSMAARDRLALVGEAAVSLLRDAYQRRD
KVAVIGFRGTEATLLVPPTRSVDVAVARLARARTGGRTPLAEGITEARRLLRRESLRPDA
RRPLVVLLTDGRATAGRDPLPRAVAAAAGLRADGHASVVVDCETSMVRLGLAARVANALG
AELIPLGGLSPADLARVA
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaccggtacccgttcagcgccgtcgtcggccacgacgaactgcgtctggccctc
acgctctgtgcgatcgcccccgcggtcggcggcgtcctcgtgcgtggtgagaagggcacg
gcgaaatcgactgcggcacgggccttggcaccattgctgccgccgcggcccgatggtgcc
gacgcccggctcgtcgagttgcccatcggtgccaccgaggaccgcgtggtcggttcgctc
gacctgcaccgagcccttggtgagggcgcggtcgacttcaccccgggactgttggccgac
gccgacggcggcattctctacgtggacgaggtgaacctgctctcggaccacctcgtggac
gtgctgctcgatgccgccgcgatgggccgggtcaccgtggaacgcgatgccgtgtcccgt
tcctatccggcccgattcgtgttggtgggcaccatgaaccccgaggagggagagctgcgg
ccgcagctgctcgaccgattcggtctcgcagtcgacgtgcgtgccagccgcgaggtggac
gtccgggtcgaggtgatgcgccgacgtctcgccttcgagtccgatcccgccggattcgcc
gccgagtacgccgccgcggacaccgctctcgcggaccggatcgccacggcccgcgagcgg
ctcccgcgggtgacgctgcccgatgccgaactgcgccgcatcgccgccgtgtgcgccgcg
ttcgacgtggacggaatgcgcgccgatctggtgatcgcccgggcggcgctggcacacgcc
gcctggcgcggcgtcgacgaggtgaccgaggacgatgtccgggtggcggccgcgctcgct
ctgccgcaccgtaagcgccgcgatcccttcgacgagcccggcctcgacgatcaggaactg
gaccgcgccttcgacgacgcccgccagaacgaggaccccgacccggacaccgaccccgat
ggcccggacgaccccgaaggcggcggcgaaccgtcggatccgaccccgccgcaaccggac
tcggctggggacgatcggcccggcactccggagggcggcacgctgcccaccgcacgacac
cgcaccgtcgccaaactgagcgtgcccgggctcggcaccggcggcgccgcagggcgccgc
tccaaggcccggtccgaccgcggcagcgtggtccgggcggcgcccgcgggcacgggctcg
ggcctgcacctcgtggcgacgctccgcgccgcggcgctgaaccaggggagccgcggtcgc
agcagcgggccgctgcgcctggcgcgagaagacttgcgcgcaccgatccgggaggccacc
gaggggaatctggtggtcttcgtcgtcgatctctccgggtccatggccgctcgcgaccgg
ctcgccctggtcggcgaggcggcggtctccttgctgcgcgacgcctaccagcggcgcgac
aaggtggccgtgatcgggttccgcggcaccgaggcaaccctgctggtgccccccacccgc
tccgtcgacgtggccgtcgccaggctcgcccgcgcccgcaccggcggccgcaccccactc
gccgagggcatcaccgaggcccgccgactgttgcgccgggagtcgctgcggcccgatgct
cggcgcccgctcgtggtgctgctcaccgacggacgtgccaccgcggggcgcgatccgttg
ccccgcgccgtggccgccgccgcgggactgcgcgctgacggtcatgcgagcgtcgtggtg
gactgcgagacctcgatggtgcgactcgggctcgccgcccgggtggcgaacgcgctgggg
gccgaactgatcccgctgggtgggctgagtcccgccgatctggcccgcgtcgcctga

DBGET integrated database retrieval system