KEGG   Tsukamurella paurometabola: Tpau_1761Help
Entry
Tpau_1761         CDS       T01228                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
tpr  Tsukamurella paurometabola
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tpr00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:tpr00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1841265..1841741
Genome map
AA seq 158 aa AA seqDB search
MIGLIWAQARSGVIGDGGGIPWHIPEDMKFFRETTAGATVVMGRKTWDSLPARFRPLPGR
TNIVVTRDRDWSADGAVVHHELVLPEGDVWVIGGGEIYAAALPSADLLAVTEVDADIPGD
TYAPSIPDGFTATEDTGWRESTSGLRYRHLTYRRTASQ
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
gtgatcggcctcatctgggcgcaggcccgtagcggagtgatcggcgacggcggcggcatc
ccctggcacatccccgaggacatgaagttctttcgtgagaccacggccggcgccaccgtt
gtcatgggccgcaagacctgggactccctgcccgcgcggttccggccgcttccgggccgc
acgaacatcgtcgtcacgcgggaccgggactggtcggccgacggtgcggtggtgcaccac
gaactggtgctgcccgagggcgacgtgtgggtgatcggtgggggagagatctacgccgcc
gcgctgccctcggccgacctgctcgcggtcaccgaggtcgatgccgacatccccggcgac
acctacgccccgtcgatcccggacggcttcaccgcgaccgaggacaccggttggcgcgag
tccacgtcgggcctgcgataccgccacctgacctaccggcgaacggcaagccagtag

DBGET integrated database retrieval system